Recombinant Mouse CX3C chemokine receptor 1 (Cx3cr1)-VLPs

Code CSB-MP897445MO
Abbreviation Recombinant Mouse Cx3cr1 protein-VLPs
MSDS
Size $620
Order now
Image
  • CSB-MP897445MO is detected by Mouse anti-6*His monoclonal antibody.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
VLPs
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
C-X3-C CKR-1;CX3CR1;mCX3CR1;Fractalkine receptor
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-354aa
Target Protein Sequence
MSTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSVFYALVFTFGLVGNLLVVLALTNSRKPKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHNAMCKLTTAFFFIGFFGGIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMFTKRKDNECLGDYPEVLQEMWPVLRNSEVNILGFALPLLIMSFCYFRIIQTLFSCKNRKKARAVRLILLVVFAFFLFWTPYNIMIFLETLKFYNFFPSCDMKRDLRLALSVTETVAFSHCCLNPFIYAFAGEKFRRYLGHLYRKCLAVLCGHPVHTGFSPESQRSRQDSILSSFTHYTSEGDGSLLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.6 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the C-X3-C chemokine fractalkine (CX3CL1) present on many early leukocyte cells; CX3CR1-CX3CL1 signaling exerts distinct functions in different tissue compartments, such as immune response, inflammation, cell adhesion and chemotaxis. CX3CR1-CX3CL1 signaling mediates cell migratory functions. Responsible for the recruitment of natural killer (NK) cells to inflamed tissues. Acts as a regulator of inflammation process leading to atherogenesis by mediating macrophage and monocyte recruitment to inflamed atherosclerotic plaques, promoting cell survival. Involved in airway inflammation by promoting interleukin 2-producing T helper (Th2) cell survival in inflamed lung. Involved in the migration of circulating monocytes to non-inflamed tissues, where they differentiate into macrophages and dendritic cells. Acts as a negative regulator of angiogenesis, probably by promoting macrophage chemotaxis. Plays a key role in brain microglia by regulating inflammatory response in the central nervous system (CNS) and regulating synapse maturation. Required to restrain the microglial inflammatory response in the CNS and the resulting parenchymal damage in response to pathological stimuli. Involved in brain development by participating in synaptic pruning, a natural process during which brain microglia eliminates extra synapses during postnatal development. Synaptic pruning by microglia is required to promote the maturation of circuit connectivity during brain development. Acts as an important regulator of the gut microbiota by controlling immunity to intestinal bacteria and fungi. Expressed in lamina propria dendritic cells in the small intestine, which form transepithelial dendrites capable of taking up bacteria in order to provide defense against pathogenic bacteria. Required to initiate innate and adaptive immune responses against dissemination of commensal fungi (mycobiota) component of the gut: expressed in mononuclear phagocytes (MNPs) and acts by promoting induction of antifungal IgG antibodies response to confer protection against disseminated C.albicans or C.auris infection. Also acts as a receptor for C-C motif chemokine CCL26, inducing cell chemotaxis.
Gene References into Functions
  1. CXCR1 mediates neuronal apoptotic cell death in ischemia. PMID: 29323156
  2. These data implicate sex differences in microglial activation in the modulation of energy homeostasis and identify CX3CR1 signalling as a potential therapeutic target for the treatment of obesity. PMID: 28223698
  3. Ang II up-regulates CX3CR1 expression in VSMCs via NADPH oxidase/ROS/p38 MAPK pathway and the CX3CL1/CX3CR1 axis contributes to the proliferative and pro-inflammatory effects of Ang II in VSMCs. PMID: 29356931
  4. CX3CR1 ablation enhanced the neurotrophic action of microglia in Mecp2KO mice PMID: 26883520
  5. These findings indicate that emotional and cognitive stress resilience involves CX3CR1-dependent basal and stress-induced alterations in hippocampal transcription PMID: 27890560
  6. The effect of CX3CR1 deletion on murine acetabular development provides suggestive evidence of a susceptibility inducing role of the CX3CR1 gene on developmental dysplasia of the hip. PMID: 29126427
  7. In Cx3cr1(-/-) mice, adult-born-granule-cells exhibited reduced spine density, dynamics and size, concomitantly with reduced contacts between Cx3cr1-deficient microglia and adult-born-granule-cells' dendritic shafts, along with increased proportion of microglia-contacted spines. PMID: 29251592
  8. reveal CX3CR1 as a novel target for the clearance of extracellular Tau PMID: 28810892
  9. These findings suggest that fractalkine receptor is not a universal regulator of synaptic plasticity, but rather has heterogeneous roles in specific brain regions and life stages. PMID: 28836393
  10. that CX3CL1-CX3CR1 signaling is a molecular mechanism capable of modulating microglial-mediated degeneration PMID: 27314452
  11. Increased fractalkine and its receptor CX3CR1 may cause a cross-talk between activated glial cells and neurons, playing an important role in the development of neuroinflammation in fructose-fed mice. PMID: 26765996
  12. CX3CR1 deficiency accelerates the development of vascular pathology in diabetic retinopathy. PMID: 27344677
  13. CX3CR1(-/-) mice did not become anhedonic in the "two hit" chronic stress paradigm, confirming resistance of these animals to chronic stress-induced mood alterations. However, there was no difference in stress hormone levels, open field performance and hypothalamic microglia distribution between the genotypes. Energy expenditure was increased in CX3CR1(-/-) mice, which may be related to their active coping behavior. PMID: 28736330
  14. Inflammatory Osteoclasts Prime TNFalpha-Producing CD4(+) T Cells and Express CX3 CR1 PMID: 27161765
  15. our study demonstrates that macrophages expressing a functional CX3CR1 receptor have an important and non-redundant role in controlling the abnormal intestinal inflammation that may lead to tissue damage. PMID: 27707514
  16. These results highlight the importance of fractalkine-CX3CR1 interaction in recruitment of macrophages into the brown adipose tissue of obese mice. PMID: 27417459
  17. Results indicate that deletion of CX3CR1 from microglia under resting conditions modifies brain areas with elevated cellular turnover independent of CX3CL1. PMID: 27639555
  18. CX3CL1 is upregulated in both human and murine tumors following VEGF signaling blockade, resulting in recruitment of CX3CR1+Ly6Clo monocytes into the tumor PMID: 28691930
  19. The CX3CL1/CX3CR1 system is essential for restricting coxsackievirus B3-induced myocarditis. PMID: 28800592
  20. Results establish an essential role for the receptor CX3CR1 in gut macrophages in resolving inflammation in the intestine, where it helps protects against colitis-associated cancer by regulating HMOX-1 expression. PMID: 28619710
  21. CX3CR1 significantly contributes to changes in microglia morphology in the proximal peri-infarct area following transient occlusion of the middle cerebral artery. Morphological alterations suggest a shift in microglia functionality integrated in the inflammatory response after stroke. Results show that CX3CR1 deficiency has no beneficial effect on lesion size neither it affects early functional outcome after stroke. PMID: 28061814
  22. Published data show that genetic deletion of CX3CR1, a microglia-specific chemokine receptor, promotes recovery after traumatic spinal cord injury in mice, a benefit achieved in part by reducing macrophage-mediated injury at the lesion epicenter. Data in the current manuscript indicate that CX3CR1 deletion changes microglia and macrophage function, creating a tissue microenvironment that enhances endogenous repair. PMID: 28264978
  23. this reduction in lesion formation was associated with reduced numbers of lesional SMCs but not macrophages within the transplanted Cx3cr-/- Apoe-/- aortic segment. No differences in frequencies of proliferating and apoptotic cells could be observed. These results indicate that CX3CR1 on resident vessel wall cells plays a key role in atherosclerotic plaque formation in transplanted aortic grafts PMID: 28234900
  24. Knockdown of the fractalkine receptor CX3CR1 in embryonic cortical precursors, or constitutive knockout of CX3CR1, causes decreased numbers of oligodendrocyte progenitor cells (OPCs) and oligodendrocytes in the postnatal cortex. PMID: 28472653
  25. Fractalkine-CX3CR1 signaling has been shown to protect neurons. PMID: 27814376
  26. In both wild-type and CX3CR1-deficient experimental autoimmune encephalomyelitis mice, NK cells are mobilized from the periphery and accumulate in the inflamed CNS. However, in CX3CR1-deficient mice, the infiltrated NK cells displayed an immature phenotype PMID: 27325505
  27. a crucial role of CX3CL1-CX3CR1 in experimental colitis, in particular for intestinal leukocyte recruitment during murine colitis, is reported. PMID: 27942903
  28. These data suggest that CX3CR1 deficiency in resident cells of the CNS affects mouse survival, HSV-1 replication control and cerebral inflammatory response whereas its deficiency in the haematopoietic system does not appear to influence the outcome of HSE. PMID: 27902351
  29. Deletion of Cx3cr1 had no effect on development of clinical signs or disease incubation period of prion disease. PMID: 26935332
  30. Authors provide evidence that interactions between CX3CL1 and CX3CR1 play crucial roles in determining the number of M1 macrophages within the skin of mice, which in turn can have dramatic effects on psoriasis-like inflammation. PMID: 26976687
  31. CX3CR1 Disruption Differentially Influences Dopaminergic Neuron Degeneration in Parkinsonian Mice Depending on the Neurotoxin and Route of Administration. PMID: 26403659
  32. Involvement of fractalkineCX3CR1 signaling and endothelial cell proliferation were also identified PMID: 26254180
  33. Some mononuclear phagocyte subsets that develop from monocytes and are distinguished by their expression of CX3CR1. CX3CR1 expression can be regulated using in vivo depletion techniques and genetic targeting. PMID: 26705686
  34. CD11c(+) CX3CR1(+) F4/80(-) DCs significantly increased during intestinal schistosomiasis in the ileal lamina propria PMID: 26303459
  35. activation of canonical Wnt signaling might contribute to the focal retinal degeneration of mouse models with Ccl2 and Cx3cr1 deficiency PMID: 26476672
  36. Results show that CX3CR1 knockout decreases phagocytosis in microglia resulting in decreased inflammation associated with alpha-syn internalization SUGGESTING THAT CX3CR1 is important in disease progression of synucleinopathies. PMID: 26469270
  37. Also icariin reduced CX3CR1 and CX3CL1 protein levels in the artery wall. In conclusion, icariin could be a potential anti-atherosclerosis agent by downregulating the expression of CX3CR1. PMID: 26802470
  38. Results of this study demonstrate for the first time that CX3CR1 modulates responses to mild TBI in a time-dependent manner PMID: 26329692
  39. Results demonstrate that dysregulated microglial responses in absence of CX3CR1 contribute to inflammatory-mediated damage of neurons in the diabetic retina PMID: 26514658
  40. survival of resident arterial macrophages depends on a CX3CR1-CX3CL1 axis within the vascular niche. PMID: 26642357
  41. CX3CR1 is important to acute skeletal muscle injury repair by regulating macrophage phagocytosis. PMID: 26443824
  42. This study showed CX3CR1 deficiency promotes muscle repair and rescues Ccl2(-/-) mice from impaired muscle regeneration as a result of altered macrophage function, including upregulated Apolipoprotein E (ApoE). PMID: 26632270
  43. Data show that fractalkine receptor CX3CR1 expression is decreased in both murine and human glioblastoma (GBM) tissue. PMID: 25987130
  44. Myocardial fractalkine expression was increased in myocardial infarction model. PMID: 26049921
  45. Mice deficient in Cx3cr1 were protected from granuloma formation and hepatic injury induced by Schistosoma japonicum eggs, as manifested by reduced body weight loss and attenuated hepatomegaly along with preserved liver function. PMID: 26035381
  46. neuronal Cx3cr1 may impact Alzheimer's disease-like pathology by modulating conformational state-dependent amyloid-beta-induced synaptotoxicity. PMID: 26038823
  47. Microbiota-mediated activation of the innate immune responses through CX3CR1 is crucial for controlling steatohepatitis progression, which recognizes CX3CR1 as an essential gatekeeper in this scenario. PMID: 26178698
  48. CX3CL1/CX3CR1 signaling is involved in LTP of C-fiber-evoked field potentials in the rodent spinal dorsal horn PMID: 25768734
  49. Results suggest fractalkine-CX3CR1 signaling pathway role in limbic seizure-induced hippocampal pathologies including microglial activation, neurodegeneration and neuroblast production PMID: 25461978
  50. CX3CR1 deficiency affected neither monocyte trafficking nor macrophage differentiation in vivo upon renal obstruction, but CX3CR1 expression in monocytes and macrophages was required for increases in fibrosis in obstructed kidneys. PMID: 26254342

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Specifically expressed in subsets of leukocytes: expressed in monocytes, subsets of T-cells and natural killer (NK) cells in the circulation, dendritic cells, as well as in microglia in the central nervous system (CNS). Expression level subdivides blood m
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*