Recombinant Mouse Catechol O-methyltransferase (Comt)

Code CSB-CF005779MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Comt; Comt1; Catechol O-methyltransferase
Species
Mus musculus (Mouse)
Expression Region
1-265
Target Protein Sequence
MLLAAVSLGLLLLAFLLLLRHLGWGLVAIGWFEFVQQPVHNLLMGGTKEQRILRHVQQHAKPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAVYQGPGSSPVKS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Gene References into Functions
  1. Miroestrol restored uterine COMT expression in beta-naphthoflavone-treated mice. PMID: 26893163
  2. This study report that genetically driven reduction in COMT enzyme activity increased cortical thickness in the prefrontal cortex (PFC) and postero-parieto-temporal cortex of male, but not female adult mice. PMID: 24658585
  3. COMT expression in the hippocampus was significantly reduced by high E2 replacement, implying increased catecholamine levels in the hippocampus of high E2 mice. PMID: 25555360
  4. COMT overexpressing mice display an increase in dopamine release capacity in the striatum, suggesting increased COMT activity may affect dopamine signaling by enhancing synaptic clearance in the cortex and changes in striatal presynaptic dopamine function PMID: 24639487
  5. These data confirm at the level of mouse working memory and human working memory-associated physiology a genetic interaction between COMT and DTNBP1. PMID: 24145376
  6. The results of this study suggest that individual differences in COMT activity do not affect primary reinforcing effects of cocaine in mice. PMID: 23011431
  7. Inhibition of COMT via serotonin binding contributes to pain hypersensitivity. PMID: 22500608
  8. COMT knockout mice were more impulsive compared with wild-type littermates. PMID: 23169629
  9. Data show that in male catechol-O-methyltransferase COMT(-/-)-mice, the total number of T-, and B-lymphocytes from spleen increased but the T-cell proliferative response decreased. PMID: 22658921
  10. decreased COMT activity was associated with some changes in feeding microstructure in rats and mice PMID: 21851556
  11. This study demonistrated that COMT deletion with elevated anxiety in females and suggest that this may be related to a heightened neuroendocrine response to acute stress in COMT KO mice. PMID: 22192380
  12. COMT deficiency in virgin female mice with intact endogenous production of estradiol results in relative protection against atherosclerosis PMID: 22009725
  13. In catechol-O-methyltransferase knock-out mice administration of tetrahydrocannabinol induced a larger increase in exploratory behavior and greater impairment in spatial working memory. PMID: 20631688
  14. Strains with the SINE haplotype (+SINE) have greater Comt1 enzymatic activity. +SINE mice also exhibit behavioral differences in anxiety assays and decreased pain sensitivity. PMID: 20659173
  15. Findings show that Comt1(B2i) (a B2 SINE insertion) results in a relatively modest difference in Comt1 expression and enzyme activity which has a demonstrable behavioral effect across a variety of outbred genetic backgrounds. PMID: 20618449
  16. the source of variation in Comt PMID: 20808911
  17. A lack of S-COMT has a notable brain-area and sex-dependent effect on the O-methylation of dopamine and 3,4-dihydroxyphenylacetic acid in the mouse brain and induces subtle change in social behavior and nociception PMID: 20617305
  18. In the mouse, the prefrontal cortex COMT contributes about one half of the total dopamine clearance. PMID: 20626558
  19. Both soluble COMT and membrane-bound COMT forms were abundantly found in microglial cells and intestinal macrophages, but also in astroglial cells. COMT was also present in some neuronal cells and nuclear COMT is not visible in S-COMT deficient mice. PMID: 20374420
  20. Findings in mice with reduced or absent COMT activity reveal its important role in the dopamine-mediated regulation of renal sodium excretion. PMID: 12188925
  21. First demonstration of the significant contribution of catechol-O-methyltransferase in modulating the dynamics of dopamine overflow in the prefrontal cortex. PMID: 17881525
  22. pregnant mice deficient in catechol-O-methyltransferase (COMT) show a pre-eclampsia-like phenotype resulting from an absence of 2-methoxyoestradiol PMID: 18469803
  23. catechol-O-methyltransferase and neuregulin-1 may influence, respectively, primarily cognitive and social endophenotypes of the overall schizophrenia syndrome. PMID: 18674597
  24. Disruption of Comt gene influenced ethanol consumption in a gender-dependent manner in mice, supporting the hypothesis that low catechol-O-methyltransferase activity is one of the predisposing factors for high alcohol consumption in males. PMID: 18684228

Show More

Hide All

Subcellular Location
[Isoform Soluble]: Cytoplasm.; [Isoform Membrane-bound]: Cell membrane; Single-pass type II membrane protein; Extracellular side.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1