Recombinant Mouse Chemokine XC receptor 1(Xcr1)

Code CSB-CF879493MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9R0M1
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence MESSTAFYDYHDKLSLLCENNVIFFSTISTIVLYSLVFLLSLVGNSLVLWVLVKYENLES LTNIFILNLCLSDLMFSCLLPVLISAQWSWFLGDFFCKFFNMIFGISLYSSIFFLTIMTI HRYLSVVSPISTLGIHTLRCRVLVTSCVWAASILFSIPDAVFHKVISLNCKYSEHHGFLA SVYQHNIFFLLSMGIILFCYVQILRTLFRTRSRQRHRTVRLIFTVVVAYFLSWAPYNLTL FLKTGIIQQSCESLQQLDIAMIICRHLAFSHCCFNPVLYVFVGIKFRRHLKHLFQQVWLC RKTSSTVPCSPGTFTYEGPSFY
Source in vitro E.coli expression system
Gene Names Xcr1
Protein Names Recommended name: Chemokine XC receptor 1 Alternative name(s): Lymphotactin receptor SCM1 receptor XC chemokine receptor 1 mXCR1
Expression Region 1-322
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for chemokines SCYC1 and SCYC2. Subsequently transduces a signal by increasing the intracellular calcium ions level. Receptor for XCL1/Lymphotactin (Probable).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed by dendritic cells from the thymus, slpeen, subcutaneous lymph nodes and mesenteric lymph nodes.
Database Links

STRING: 10090.ENSMUSP00000077813

UniGene: Mm.390241

Pathway Chemokine signaling pathway

Related Products

Xcr1 Proteins

Xcr1 Proteins for Mus musculus (Mouse)

Xcr1 ELISA Kit

Xcr1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.