Recombinant Mouse Claudin-3 (Cldn3)

Code CSB-CF897449MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cldn3; Cpetr2; Claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2
Species
Mus musculus (Mouse)
Expression Region
1-219
Target Protein Sequence
MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAGLYVGWAAAALQLLGGALL CCSCPPRDKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. Claudin-3 was present in the fila olfactoria from the epithelium to the olfactory nerve and in the main and accessory olfactory bulb. PMID: 27943232
  2. Reg I may play a role in the maintenance of mucosal barrier function by inducing tight junction proteins such as claudins 3 and 4. PMID: 27055226
  3. Intracellular zinc has an essential role in the maintenance of the intestinal epithelial tight junction barrier through regulation of occludin proteolysis and claudin-3 transcription. PMID: 27151944
  4. localization of Cldn3, Cldn7 and Cldn10 proteins in the different compartments of murine endometrium up to day 8.5 of pregnancy (dpc) as well as in human endometrium and first trimester decidua PMID: 26340953
  5. claudin-3 and claudin-5 expression is increased by DHEAS and tight junction formation is stimulated via a Gnalpha11-coupled receptor in Sertoli cells PMID: 26938869
  6. Cldn3(-/-) mice are fertile and show no Sertoli cell tight junction structural defects, even during the stages of Sertoli cell tight junction remodeling when preleptotene spermatocytes translocate from the basal to the adluminal compartment. PMID: 24825397
  7. Study highlights a profound role for the choroid plexus in the pathogenesis of multiple sclerosis, and implies that CLDN3 may be regarded as a crucial and novel determinant of blood-cerebrospinal fluid barrier integrity PMID: 24356983
  8. Seminiferous stage-specific expression and localization of claudin 3 during spermatogenesis regulate the progression of meiosis by promoting germ cell migration across the blood-testis barrier. PMID: 23677978
  9. Claudin-3 expression in uterine luminal epithelium is stimulated by progesterone and suppressed by heparin-binding epidermal growth factor-like growth factor. PMID: 23909989
  10. Claudin-3 and Clara cell 10 kDa protein were identified as possible markers of early tobacco smoke-induced epithelial injury along alveolar ducts. PMID: 22659244
  11. the results indicate that Grhl2 regulates epithelial morphogenesis through transcriptional up-regulation of Cldn3 and Cldn4, as well as of Rab25, which increases the Cldn4 protein and its localization at TJs PMID: 22696678
  12. Claudin-3 is expressed at the variety of epithelial tissues in inner ear including Organ of Corti, stria vascularis, Reissner's membrane, spiral limbus, vestibular sensory epithelia, dark cell area. PMID: 14698084
  13. Mechanism of Clostridium perfringens enterotoxin interaction with claudin-3/-4 protein suggests structural modifications of the toxin to target specific claudins PMID: 22128179
  14. Claudin-3 in the apical-most regions maintains the impermeable tight junctions during lactation, and claudin-4 contributes to the permeability changes of them immediately after parturition and weaning. PMID: 21912970
  15. Cldn3 may therefore promote tubule formation and expansion of the ureteric bud epithelium PMID: 21775479
  16. internalization of claudin 3 plays a crucial role in the remodeling of tight junctions PMID: 14996944
  17. In the absence of follicle-stimulating hormone receptor signaling, claudin-3 is selectively upregulated in ovarian surface epithelium and tumors in comparison to wild type. PMID: 17217615
  18. Claudin-3 and claudin-4 receptors are highly overexpressed in carcinosarcoma PMID: 17545541
  19. treatment of mice with nonimmunostimulatory 2'-OMe modified CLDN3 siRNA was as effective in suppressing tumor growth as unmodifed siRNA PMID: 19208807
  20. analysis of the interaction between Clostridium perfringens enterotoxin fragments and claudin-3 PMID: 19429681

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Expressed at high levels in liver and lung and, at lower levels, in kidney and testis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1