Product Details

Purity

≥ 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC50 is 4.027-6.270 ng/mL.The VLPs (CSB-MP3838) is negative control. ②Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC50 is 7.349-12.12 ng/mL.The VLPs (CSB-MP3838) is negative control.

Target Names

Cldn6

Uniprot No.

Q9Z262

Alternative Names

Claudin-6; Skullin; Cldn6

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

1-219aa

Target Protein Sequence

MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV

Mol. Weight

24.8 kDa

Protein Length

Full Length

Tag Info

C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Claudin-6 functions as a tight junction protein with emerging significance in cancer biology, where its aberrant expression marks certain tumor types and positions it as a therapeutic target. This full-length construct (aa 1–219) displays quantifiable binding to anti-CLDN6/9 recombinant antibodies in functional ELISA, with EC50 values of 4.027–6.270 ng/mL and 7.349–12.12 ng/mL depending on antibody format, demonstrating that the protein adopts a conformation recognized by therapeutic-relevant binders. These binding kinetics support use in antibody development and validation workflows, particularly for screening candidate therapeutics against native epitopes, and provide a suitable basis for cell adhesion assays investigating claudin-mediated junction dynamics in tumor models. Mammalian expression yields purity greater than 95% by SEC-HPLC and endotoxin below 1.0 EU/μg, meeting the quality thresholds commonly required for cell-based migration and invasion studies where low endotoxin is critical to avoid confounding inflammatory responses.

Target Background

Function

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Gene References into Functions

Cldn6 was markedly decreased in the lungs of mice exposed to acute tobacco sm PMID: 27982694
These data reveal captivating information suggesting a role for Cldn6 in lungs exposed to tobacco smoke and suggest that further research is necessary in order to fully explain roles for tight junctional components such as Cldn6 PMID: 27763528
Over-expression of Claudin 6 during embryogenesis delays lung morphogenesis. PMID: 26198145
Cldn6 is expressed by pulmonary epithelium during lung organogenesis. PMID: 24970044
The Inv-Cldn6-CDelta206 transgenic mice displayed a developmental delay in epidermal permeability barrier formation, as shown by the expression of keratins and Cldns, and by X-Gal penetration assays. PMID: 20106878
the normally robust injury response mechanism of the epidermis is lost in the aging Involucrin-Cldn6-CDelta196 transgenic epidermis PMID: 19915705
Permeability barrier dysfunction in transgenic mice overexpressing claudin 6. PMID: 11923212
Cldn6 plays a role in the differentiation processes of the epidermis and hair follicle PMID: 15908185
Claudin-6 mRNA was found to be differentially expressed in four different adipose tissues, and up-regulated in each fat depot of mice fed a high-fat diet. Levels of claudin-6 transcripts were increased during differentiation of 3T3-L1 ce PMID: 16306693
developmentally expressed claudin isoforms include claudin 6, claudin 9, and claudin 13 PMID: 16774906
Results demonstrate that the overexpression of a tail truncation mutant of claudin 6 (Cldn6) mislocalizes Cldn6 and other Cldn proteins to the cytoplasm and triggers a postnatal increase in proliferation and aberrant differentiation of the epidermis. PMID: 16847338
Tight junctions containing claudin 6 are essential for blastocyst formation in preimplantation mouse embryos PMID: 17980358
A lineage analysis of the fate of Cldn6-expressing embryonic endoderm cells is relevant to the development of the pancreas, lung, and liver. PMID: 18213590
Expression analysis in mice has shown that Claudin-6 is one of the few genes that allows for the targeting of the definitive endoderm throughout the entire anterior-posterior axis, before and after gut tube patterning. PMID: 18213590

Hide All

Subcellular Location

Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Protein Families

Claudin family

Tissue Specificity

Expressed mostly in embryonic tissues.

Database Links

KEGG: mmu:54419

STRING: 10090.ENSMUSP00000024699

UniGene: Mm.86421

Code	CSB-MP3347MO
Abbreviation	Recombinant Mouse Cldn6 protein-VLPs (Active)
MSDS	MSDS Datasheet
Size	$620
	Order now
Image	CSB-MP3347MO is detected by Mouse anti-6*His monoclonal antibody. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/ml can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC₅₀ is 4.027-6.270 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/ml can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC₅₀ is 7.349-12.12 ng/mL.The VLPs (CSB-MP3838) is negative control. Biological Activity Assay The purity of VLPs was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Claudin-6 (Cldn6)-VLPs (Active)

Product Details

Customer Reviews and Q&A

Target Background

×CloseMessage