Recombinant Mouse Claudin-6 (Cldn6)-VLPs (Active)

In Stock
Code CSB-MP3347MO
Abbreviation Recombinant Mouse Cldn6 protein-VLPs (Active)
MSDS
Size $456
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA1HU). The EC50 is 4.027-6.270 ng/mL.The VLPs (CSB-MP3838) is negative control. ②Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody(CSB-RA005508MA3HU). The EC50 is 7.349-12.12 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
Uniprot No.
Alternative Names
Claudin-6; Skullin; Cldn6
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-219aa
Target Protein Sequence
MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV
Mol. Weight
24.8 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. Cldn6 was markedly decreased in the lungs of mice exposed to acute tobacco sm PMID: 27982694
  2. These data reveal captivating information suggesting a role for Cldn6 in lungs exposed to tobacco smoke and suggest that further research is necessary in order to fully explain roles for tight junctional components such as Cldn6 PMID: 27763528
  3. Over-expression of Claudin 6 during embryogenesis delays lung morphogenesis. PMID: 26198145
  4. Cldn6 is expressed by pulmonary epithelium during lung organogenesis. PMID: 24970044
  5. The Inv-Cldn6-CDelta206 transgenic mice displayed a developmental delay in epidermal permeability barrier formation, as shown by the expression of keratins and Cldns, and by X-Gal penetration assays. PMID: 20106878
  6. the normally robust injury response mechanism of the epidermis is lost in the aging Involucrin-Cldn6-CDelta196 transgenic epidermis PMID: 19915705
  7. Permeability barrier dysfunction in transgenic mice overexpressing claudin 6. PMID: 11923212
  8. Cldn6 plays a role in the differentiation processes of the epidermis and hair follicle PMID: 15908185
  9. Claudin-6 mRNA was found to be differentially expressed in four different adipose tissues, and up-regulated in each fat depot of mice fed a high-fat diet. Levels of claudin-6 transcripts were increased during differentiation of 3T3-L1 ce PMID: 16306693
  10. developmentally expressed claudin isoforms include claudin 6, claudin 9, and claudin 13 PMID: 16774906
  11. Results demonstrate that the overexpression of a tail truncation mutant of claudin 6 (Cldn6) mislocalizes Cldn6 and other Cldn proteins to the cytoplasm and triggers a postnatal increase in proliferation and aberrant differentiation of the epidermis. PMID: 16847338
  12. Tight junctions containing claudin 6 are essential for blastocyst formation in preimplantation mouse embryos PMID: 17980358
  13. A lineage analysis of the fate of Cldn6-expressing embryonic endoderm cells is relevant to the development of the pancreas, lung, and liver. PMID: 18213590
  14. Expression analysis in mice has shown that Claudin-6 is one of the few genes that allows for the targeting of the definitive endoderm throughout the entire anterior-posterior axis, before and after gut tube patterning. PMID: 18213590

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Expressed mostly in embryonic tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*