Recombinant Mouse Cyclic nucleotide-gated cation channel beta-3(Cngb3)

Code CSB-CF881328MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Cngb3
Uniprot No. Q9JJZ9
Alternative Names Cngb3; Cng6; Cyclic nucleotide-gated cation channel beta-3; Cone photoreceptor cGMP-gated channel subunit beta; Cyclic nucleotide-gated cation channel modulatory subunit; Cyclic nucleotide-gated channel beta-3; CNG channel beta-3; Cyclic nucleotide-gated channel subunit CNG6
Species Mus musculus (Mouse)
Expression Region 1-694
Target Protein Sequence MLKSLTVKFNKVNPMEGRMEKKLCPNLSSLSQPTIAQGDNQSEKEPLRSRTPITFEKSHS KEDNSTGENSLRDFTPNPDPECRAELTRTMAEMEKTRTGKERPVSFKTKVLETSIINEYT DAHLHNLVERMRERTALYKKTLTEEENFPEVEASSQTAMSTNISPKQENNSKLKEHQDTF SFKPQRVPVKEHLRRMILPRSIDSYTDRVYLLWLLLVTIAYNWNCWLLPVRLVFPCQTPD NKNYWIITDIVCDIIYLCDILLIQPRLQFVRGGEIIVDSNELKRNYRSSTKFRMDVASLL PFEVLYIFFGVNPIFRANRILKYTSFFEFNHHLESIMDKAYVYRVIRTTGYLLFLLHINA CVYYWASDYEGIGSTKWVYNGEGNKYLRCFYWAVRTLITIGGLPEPQTSFEIVFQFLNFF SGVFVFSSLIGQMRDVIGAATANQNYFQACMDHIIAYMNKYSIPQSVQYRVRTWLEYTWN SQRILDESNLLENLPTAMQLSIALDINFSIIDKVELFKGCDTQMIYDLLLRLKSTIYLPG DFVCKKGEIGKEMYIIKHGEVQVLGGPDGAQVLVTLKAGSVFGEISLLAKGGGNRRTADV VAHGFANLLTLDKKTLQEILLHYPTSKKLLMKKAKILLSQKGKTTQAIPARPGPAFLFPP KEETPRMLKVLLGNTGKVDLGRLLKGKRKTTTQK
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cGMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGA3.
Gene References into Functions
  1. CNGB3 regulates cone light response kinetics and the channel structural flexibility. PMID: 26893377
  2. This work investigated the functional modulation of cone CNG channel by exploring the channel-interacting proteins. PMID: 24664681
  3. Cone CNG channel is a heterotetrameric complex likely at a stoichiometry of three CNGA3 and one CNGB3. PMID: 22183405
  4. RDS does not interact with the cone CNG. PMID: 20238003
  5. The heteromeric cyclic nucleotide-gated channel adopts a 3A:1B stoichiometry PMID: 12432397

Show More

Hide All

Subcellular Location Membrane; Multi-pass membrane protein.
Protein Families Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGB3 subfamily
Tissue Specificity Small subset of retinal photorecptor cells and testis.
Database Links

KEGG: mmu:30952

STRING: 10090.ENSMUSP00000100064

UniGene: Mm.445778

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1