Recombinant Mouse Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit(Ddost)

Code CSB-CF006594MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O54734
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence GPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIIIEQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD
Source in vitro E.coli expression system
Gene Names Ddost
Protein Names Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit Short name= DDOST 48 kDa subunit Short name= Oligosaccharyl transferase 48 kDa subunit EC= 2.4.1.119
Expression Region 29-441
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Required for the assembly of both SST3A- and SS3B-containing OST complexes. Required for efficient N-glycosylation.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type I membrane protein
Protein Families DDOST 48 kDa subunit family
Database Links

KEGG: mmu:13200

STRING: 10090.ENSMUSP00000030538

UniGene: Mm.470295

Pathway Protein processing in endoplasmic reticulum

Related Products

Ddost Proteins

Ddost Proteins for Mus musculus (Mouse)

Ddost ELISA Kit

Ddost ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.