Recombinant Mouse Fms-related tyrosine kinase 3 ligand (Flt3lg)

Code CSB-CF008734MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Flt3lg; Flt3l; Fms-related tyrosine kinase 3 ligand; Flt3 ligand; Flt3L; SL cytokine
Species
Mus musculus (Mouse)
Expression Region
27-232
Target Protein Sequence
GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Gene References into Functions
  1. These observations emphasize the potential of Flt3L as an adjuvant for colon cancer DNA vaccines. PMID: 30111221
  2. our study demonstrates that Flt3L acts as an important regulator of ILCs lymphopoiesis and it can be used as a tool to expand and study ILCs precursors in the BM. PMID: 29317685
  3. Flt3L could enhance the efficacy of immune checkpoint blockades in glioblastoma via expanding CD103+ dendritic cells and downstream antitumor immune response. PMID: 28109087
  4. Intratumoral administration of the STING agonist cyclic di-GMP (CDG) or Flt3 Ligand (Flt3L) augmented the therapeutic effect of systemic triple checkpoint modulation and promoted the cure of 75% of mice with bilateral TRAMP-C2; however, when all agents were administered locally, only CDG mobilized abscopal immunity PMID: 28674082
  5. both Flt3 ligand (FL) and IL-7 regulate B-cell commitment in a permissive manner: FL by inducing proliferation of Ly6D(+)CD135(+)CD127(+)CD19(-) progenitors and IL-7 by providing survival signals to these progenitors PMID: 27911806
  6. these results demonstrate that the lack of Flt3L mRNA expression in hematopoietic stem cells is yet another marker which further defines the status of long-term repopulating -hematopoietic stem cells PMID: 28667750
  7. this study shows that ionizing radiation induces a decrease of CD8+ dendritic cells and Th1/Th2 shift, which was reversed by Flt3 ligand treatment, suggesting a novel mechanism for radiation-induced immunosuppression PMID: 28314222
  8. may be mediated by Flt3L- and MMP-9-dependent mobilization of dendritic cells PMID: 26604429
  9. Bone marrow-derived CD117+ hematopoietic progenitor cells differentiate into thymic dendritic cells in the fetal thymus organ culture system in the presence of Flt3L. PMID: 26397863
  10. Flt3L significantly contributes to innate lymphoid cells and Peyer's patches development by targeting lymphoid progenitor cells during fetal and adult life. PMID: 26851220
  11. unlike G-CSF, Flt3-L had an indirect effect on EI macrophages, as it was not detected at the surface of EI macrophages or erythroid progenitors. PMID: 26607596
  12. Study showed shown Flt3L-dependent accumulation of a population of DNGR-1(CLEC9A)-EGFP+ CD45h CD11blow MHCII+ myeloid cells in the brain PMID: 26184558
  13. Data indicate that Flt3 ligand knockout (Flt3L-/-) mice are unable to control infection with Toxoplasma gondii. PMID: 26385522
  14. inhibition of the calcineurin-nuclear factor of activated T cells pathway enhances the proliferation of granulocyte-monocyte progenitors both in vitro and in vivo PMID: 25100642
  15. Flt3L(-/-) mice showed a marked decrease in clinical arthritis scores and incidence of arthritis in both acute and chronic phases of CIA compared with WT mice. Moreover, decreased synovial inflammation and joint destruction was observed. PMID: 24064002
  16. Flt3L enhances global T cell and humoral immunity as well as both the numbers and antigen capture capacity of migratory dendritic cells and classical lymphoid-resident dendritic cells PMID: 25135299
  17. Here, we build on the observation that Langerin-CD11b- migrating dendritic cells are Flt3L dependent and strongly Flt3L responsive, which may relate them to classical dendritic cells. PMID: 24288007
  18. Flt3 ligand mediates STAT3-independent expansion but STAT3-dependent activation of myeloid-derived suppressor cells. PMID: 24639346
  19. Flt3L promotes cell cycle exit that is necessary for myogenic differentiation. PMID: 23704355
  20. findings imply that Flt3L promotes effective innate immunity against malaria infection mediated by interplay among varieties of innate immune cells PMID: 24400637
  21. Cerebrospinal Flt3 ligand correlates to tau protein levels in primary Sjogren's syndrome. PMID: 23837643
  22. Flt3l preferentially stimulates expansion of the CD8-alpha(+) dendritic cell subset or its BDCA3(+) human dendritic cell equivalent and has a substantial impact on the magnitude of T cell activation PMID: 23685841
  23. We suggest that high systemic levels of Flt3L have potential to modulate autoreactivity and autoimmunity. PMID: 23349985
  24. data suggest that Flt3L combined with low-dose of Rapa could be an effective therapeutic approach to induce tolerance in clinical setting of transplantation PMID: 23056267
  25. Flt3L controls the development of radiosensitive dendritic cells in the meninges and choroid plexus of the steady-state mouse brain. PMID: 21788405
  26. Interleukin-2 inhibits FMS-like tyrosine kinase 3 receptor ligand (flt3L)-dependent development and function of conventional and plasmacytoid dendritic cells. PMID: 21262836
  27. PI3K-mTOR signaling downstream of Flt3L controls Dendritic cells (DCs) development, and its restriction by Pten ensures optimal DC pool size and subset composition. PMID: 20933441
  28. Prophylactic treatment of burn-injured mice with dendritic cell growth factor FLT3 ligand significantly increases resistance to burn wound infections in a dendritic cell-dependent manner that is correlated closely with enhanced bacterial clearance. PMID: 20679533
  29. Flt3L-pretreatment expanded the intestinal dendritic cell pool but aggravated intestinal inflammation and increased the mortality of endotoxemic mice rather than enhancing their resistance to bacterial translocation. PMID: 19802694
  30. show that Flt3L DC efficiently crosspresent HIV gag via the DEC-205 receptor, about 100 times more effective than non-targeted gag. PMID: 19830741
  31. dramatically expanded the CD8 alpha(+) dendritic cell(DC) subset, poor stimulators of allogeneic T-cell responses. PMID: 11861301
  32. effect of recombinant murine Flt-3 ligand on dendritic cell populations in mouse spleen PMID: 11877288
  33. Mechanisms of Flt3 ligand-induced T cell regulation include not only the expansion of dendritic cell subsets, but also the preferential expansion of type 1-effector/memory T cell populations. PMID: 12188034
  34. potential autocrine role of flt3 ligand in regulation of the earliest lymphoid commitment step from hematopoietic stem cells PMID: 12387740
  35. in vivo function of Flt3L-generated dendritic cells PMID: 12393694
  36. Large numbers of bone marrow-derived murine CD11c+B220+ pre-dendritic cells (pDC) can be generated with Flt3 ligand as the sole exogenous differentiation/growth factor. PMID: 12471102
  37. Levels of E2A protein expression in B cell precursors are stage-dependent and are inhibited by stem cell factor but not by IGF-1 or Flt3-L. PMID: 12482503
  38. Findings demonstrate that Flt3L has distinct effects on dendritic cell (DC) development and suggest an important role for Flt3L in generating DC that have tolerogenic effects on T cells. PMID: 12646617
  39. expression on the surface of total bone marrow cells and different hemopoietic precursor cells correlated with their capacity to form dendritic and plasmacytoid predendritic cells PMID: 12874262
  40. Interleukin-3 and flt3 ligand induce expression of antiapoptotic Bcl-2 family genes. PMID: 12960281
  41. An expression vector containing the Flt3 ligand gene given intranasally results in Flt3 expression in the nasal tract enhancing specific antibody responses, instead of tolerance induction, through a dramatic expansion of activated mature dendritic cells. PMID: 15004163
  42. Histocompatibility-mismatched cardiac allografts from mice genetically deficient in Flt3 ligand undergo markedly extended, but not indefinite, survival in unmodified (nonimmunosuppressed) wild-type recipients. PMID: 15128773
  43. Flt3-ligand treatment and/or the establishment of mixed chimerism in prediabetics may provide a benign and novel approach to treat diabetes. PMID: 15277378
  44. development of vascular sclerosis and alloimmune reactivity in wild-type C57BL/6 (B6) and Flt3L-/- B6 (H2b) recipients of aortic allografts from normal BALB/c (H2d) donors PMID: 15849537
  45. Our results provide a rationale for the use of FL concentration as a biological indicator of residual hematopoiesis after heterogeneous irradiation. PMID: 16953669
  46. These results validate the OP9-DL1 model for the analysis of T-cell development from bone marrow-derived progenitor cells, and demonstrate specific roles of SCF, IL-7, and Flt3L in promoting efficient T-lineage differentiation. PMID: 17157170
  47. morphological features could be indicative of the maturation and distinct functional state of dendritic cells, and this could be associated with underlying mechanisms of Flt3 ligand-induced immunomodulation in allergic asthma PMID: 17182033
  48. FLT3LG plays a crucial role in sustaining conventional B lymphopoiesis and in promoting immune reconstitution after myeloablation and bone marrow transplantation PMID: 17379745
  49. Mature mFlt3 ligand bone marrow-derived DCs were immunogenic and exacerbated the clinical disease course of experimental autoimmune encephalomyelitis. PMID: 17855499
  50. thymic stromal cell-mediated Flt3 ligand-Flt3 receptor interactions are important in the reconstitution of thymopoiesis after lethal irradiation and HSCT, are relevant to the expression of the Flt3 receptor on intrathymic T cell progenitors. PMID: 18299401

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted. Note=Biologically active.; [Isoform 4]: Secreted. Note=Inactive.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1