Recombinant Mouse G-protein coupled receptor family C group 5 member B(Gprc5b)

Code CSB-CF835660MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q923Z0
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Mus musculus (Mouse)
Sequence ENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKDKE RKRPVCLHFLFLLGTLGLFGLTFAFIIQMDETICSIRRFLWGVLFALCFSCLLSQAWRVR RLVRQGTSPASWQLVSLALCLMLVQVIIATEWLVLTVLRDTKPACAYEPMDFVMALIYDM VLLAITLAQSLFTLCGKFKRWKVNGAFILVTTFLSALIWVVWMTMYLFGNSLIKQGDAWS DPTLAITLAASGWVFVIFHAIPEIHYTLLPPLQENPPNYFDTSQPRMRETAFDEEMHLPR AYMENKAFSMDEHNAALRSAVGFSNGSLEQRSSSLGKKPSSLGNRPSAPFRSNVYQPTEM AVVLNGGTIPTAPPSHTGRHHW
Source in vitro E.coli expression system
Gene Names Gprc5b
Protein Names Recommended name: G-protein coupled receptor family C group 5 member B Alternative name(s): Retinoic acid-induced gene 2 protein Short name= RAIG-2
Expression Region 29-410
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Unknown. This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 3 family
Database Links

KEGG: mmu:64297

UniGene: Mm.103439

Related Products

Gprc5b Proteins

Gprc5b Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.