Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit gamma (Fcer1g)

Code CSB-CF008533MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Fcer1g; Fce1g; High affinity immunoglobulin epsilon receptor subunit gamma; Fc receptor gamma-chain; FcRgamma; Fc-epsilon RI-gamma; IgE Fc receptor subunit gamma; FceRI gamma
Species
Mus musculus (Mouse)
Expression Region
19-86
Target Protein Sequence
LGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQ
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells. As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset. Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (Probable). May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation. Also involved in integrin alpha-2/ITGA2-mediated platelet activation.
Gene References into Functions
  1. CD23 deficiency impacts the early cellular event of B-cell receptor (BCR) activation. PMID: 27181049
  2. Dock10 negatively regulates membrane CD23 expression; negative regulation of CD23 expression by Dock10 could play a role in B cell maturation and function PMID: 27502165
  3. data are significant in uncovering a latent, but potent, negative-regulatory role for Myd88 and Fcer1g in the late stages of B cell responses; such roles could limit acute responses; however, they could be particularly significant in chronic responses, such as autoimmunity and chronic infection PMID: 28659358
  4. FcgammaR-mediated Syk activation leads to NLRP3 inflammasome-dependent IL-1beta production in macrophages and suggests that an Nlrp3- and IL-1R-dependent process contributes to the IgA response important for protection against Francisella tularensis LVS. PMID: 27365531
  5. this study reveal an autonomous membrane IgE signaling mechanism that normally prevents IgE(+) memory B cells and long-lived plasma cells formation, providing insights into the molecular pathogenesis of allergic diseases. PMID: 27428827
  6. Galectin-3 regulates IgE receptor signaling in mast cells. PMID: 26929198
  7. these results identify a previously unproven mechanism in which epithelial CD23 plays a central role in the development of allergic inflammation PMID: 25783969
  8. In mast cells, ORMDL3 functions predominantly as a negative regulator of FcepsilonRI-mediated signaling events leading to the expression of proinflammatory mediators and chemotaxis. PMID: 26407610
  9. Data show that although phospholipase D PLD1 deficiency impaired Fc epsilon receptor FcepsilonRI-mediated signaling and mast cell function, phospholipase D PLD2 deficiency actually enhanced these pathways. PMID: 26392467
  10. Glomerulonephritis in FcRgamma-/- chimeras was no different from wild type. PMID: 25565310
  11. Acidic pH augments Fc-epsilon-RI-mediated production of IL-6 and IL-13 in mast cells. PMID: 26196745
  12. Canonical tyrosine residues mutation in FceRIg ITAM (Y65 and Y76) reveals that these two tyrosine residues in gamma subunit are required for its interaction with type II PtdIns 4-kinases. PMID: 24481753
  13. Data indicate that phosphorylation of Tyr114 and Tyr259 of prohibitin (PHB) is critical for the association of PHB with FcRI and Syk. PMID: 24023254
  14. critical for TGFbeta2-treated macrophage-induced tolerance PMID: 23643295
  15. plays role in beta2 adrenergic receptor-induced increase in IgE on B cells PMID: 24140643
  16. the CD23 surface level and serum IgE level are uncoupled and that neither is directly regulated by the mutations within the CD23 coding region. PMID: 23646151
  17. these data reveal a novel role for FcRgamma in promoting peripheral T cell apoptosis in Fas-deficient mice, which may be of significant value in understanding autoimmune lymphoproliferative syndromes. PMID: 23313147
  18. Fcgamma receptor deficiency attenuates diabetic nephropathy in mice. PMID: 22859852
  19. Low affinity IgE competes with high affinity IgE for binding to Fcepsilon receptors and prevents anaphylaxis and is thus beneficial. PMID: 22249450
  20. Rab35 regulates phagosome formation through recruitment of ACAP2 in macrophages during FcgammaR-mediated phagocytosis. PMID: 22045739
  21. regulates T helper cell differentiation through FcgammaRIII mediated dendritic cell cytokine modulation PMID: 20494341
  22. Experiments with knockout mice show that the high-affinity FC receptors for IGG and IGE are necessary for Brugia microfilaria clearance. PMID: 11920579
  23. data indicate that ligation of Fcgamma receptors activates Lyn followed by Syk kinase during phagocytosis PMID: 12056610
  24. that CD23 on murine Langerhans cells may be involved in IgE-mediated immune responses. PMID: 12164935
  25. Fc epsilon RI gamma-mediated signals differentially regulate the receptor expression, activation, and survival of mast cells and systemic anaphylaxis. PMID: 14764707
  26. FcRgamma-mediated signal transduction is involved in osteoclast differentiation. PMID: 15184345
  27. LAB shares a redundant function with LAT to play a positive role in FcepsilonRI-mediated signaling. PMID: 15477350
  28. These results demonstrate that expression of FcRgamma, most likely FcgammaRI, on APCs is important during the sensitization phase for the development of allergic airway inflammation and airway hyperresponsiveness. PMID: 17182587
  29. These results suggest that the restoration of FcRgamma/Fyn signaling represents a new approach for the treatment of demyelinating diseases. PMID: 17290413
  30. Fc receptors gamma chain may play the pivotal role in endothelial dysfunction through oxidative stress induced by hypercholesterolaemia. PMID: 18694873
  31. Data show that a pathway involving Fgr, DAP12 and FcRgamma is involved in the initial signaling events downstream of E-selectin-engaged PSGL-1 that are required to initiate neutrophil slow rolling. PMID: 18794338
  32. Data suggest that flagellin-specific IgG/Fc gamma receptor I complex immune responses activate mast cells in the intestine and play important roles in the pathogenesis of intestinal immune inflammation. PMID: 18974296
  33. Suppression of experimental immune thrombocytopenic purpura by human C-reactive protein (CRP)-treated splenocytes requires Fc gamma receptor type I on the donor macrophage and Fc gamma receptor type IIb in the recipient mice. PMID: 19155486

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
CD3Z/FCER1G family
Tissue Specificity
Expressed in mast cells (at protein level). Expressed in basophils (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1