Recombinant Mouse Interleukin-3 receptor subunit alpha(Il3ra)

Code CSB-CF011658MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P26952
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLLYRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA
Source in vitro E.coli expression system
Gene Names Il3ra
Protein Names Recommended name: Interleukin-3 receptor subunit alpha Short name= IL-3 receptor subunit alpha Short name= IL-3R subunit alpha Short name= IL-3R-alpha Short name= IL-3RA Alternative name(s): Interleukin-3 receptor class II alpha chain CD
Expression Region 17-396
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function In mouse, there are two classes of high-affinity IL3 receptors. One contains an IL3-specific beta subunit and the other contains the beta subunit also shared by high-affinity IL5 and GM-CSF receptors.
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, Note=Expressed on the cell surface, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system, Single-pass type I membrane protein
Protein Families Type I cytokine receptor family, Type 5 subfamily
Database Links

KEGG: mmu:16188

STRING: 10090.ENSMUSP00000088079

UniGene: Mm.425857

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Hematopoietic cell lineage

Related Products

Il3ra Proteins

Il3ra Proteins for Mus musculus (Mouse)

Il3ra ELISA Kit

Il3ra ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.