Recombinant Mouse Leukotriene B4 receptor 1 (Ltb4r)

Code CSB-CF013221MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Ltb4r
Uniprot No.
Alternative Names
Ltb4r; Bltr; Ltb4r1; Leukotriene B4 receptor 1; LTB4-R 1; LTB4-R1
Species
Mus musculus (Mouse)
Expression Region
1-351
Target Protein Sequence
MAANTTSPAAPSSPGGMSLSLLPIVLLSVALAVGLPGNSFVVWSILKRMQKRTVTALLVL NLALADLAVLLTAPFFLHFLARGTWSFREMGCRLCHYVCGISMYASVLLITIMSLDRSLA VARPFMSQKVRTKAFARWVLAGIWVVSFLLAIPVLVYRTVKWNNRTLICAPNYPNKEHKV FHLLFEAITGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHL VNLVEAGRTVAGWDKNSPAGQRLRLARYVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF VVKLLEGTGSEVSSTRRGGTLVQTPKDTPACPEPGPTDSFMTSSTIPESSK
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Gene References into Functions
  1. Inhibiting the LTB4/BLT1 signaling pathway via AMPK activation is a potential treatment strategy for septic cardiac dysfunction because it efficiently attenuates cardiac apoptosis, which may occur via the inhibition of inflammation and mitochondrial dysfunction. PMID: 28290498
  2. BLT1 signalling dampens the progression of APAP hepatotoxicity. PMID: 27404729
  3. LTB4-BLT1 axis contributes to cisplatin-induced acute kidney injury by mediating kidney recruitment of neutrophils, which induce inflammation and apoptosis in the kidney. PMID: 28318626
  4. These results demonstrate the importance of ATB2 cells in obesity-induced insulin resistance and suggest that inhibition of the LTB4/LTB4R1 axis might be a useful approach for developing insulin-sensitizing therapeutics PMID: 28192375
  5. study demonstrates that the LTB4/BLT1 axis plays a critical role in acute injury phase to promote bleomycin -induced lung fibrosis, and it suggests that early interruption of the LTB4/BLT1 axis in some inflammatory diseases could prevent the later development of tissue fibrosis PMID: 28077599
  6. This study demonstrates that LTB4 promotes macrophage phagocytosis of bacteria via BLT1, and that BLT2 can fulfill this role in the absence of BL PMID: 28053185
  7. These results demonstrate a critical role for both BLT1 and CXCR3 in cytotoxic T lymphocyte (CTL) migration to tumors and thus may be targeted to enhance efficacy of CTL-based immunotherapies. PMID: 27465528
  8. Our data show that LTB4 and its receptor BLT1 exacerbate synovial inflammation in vivo and bone resorption in vitro PMID: 27895169
  9. the data show that the two leukotriene B4 receptors have opposing roles in the sensitization of peripheral sensory neurons forming a self-restricting system. PMID: 28242764
  10. Our results highlight LTB4/BLT1 as absolutely critical drivers of murine pemphigoid disease-like skin inflammation. PMID: 28108297
  11. Selective BLT1 inhibition with LSN2792613 reduces inflammation and apoptosis following IR, resulting in reduced IS, and therefore might be a promising strategy to prevent myocardial IR injury. PMID: 26449403
  12. that Leukotriene B4-LTB4 receptor type 1 axis contributes not only to the peripheral inflammation but also to the neuronal activation in the spinal cord induced by intraplantar formalin injections PMID: 25889478
  13. The results demonstrate that the LTB4 -BLT1 axis contributes to oxazolone-induced contact dermatitis by mediating skin recruitment of neutrophils, which are a major source of LTB4 that sequentially direct CD8(+) T-cell homing to oxazolone-challenged skin. PMID: 25959240
  14. BLT1 and BLT2 are therefore potential targets for the development of novel drugs. PMID: 25480980
  15. Low leukotriene B4 receptor 1 leads to ALOX5 downregulation at diagnosis of chronic myeloid leukemia. PMID: 25193960
  16. Observations elucidate a novel role of the LTB4-Ltb4r1 signaling pathway in hepatocyte and myocyte insulin resistance. PMID: 25706874
  17. The leukotriene B/BLT axis is a key determinant in susceptibility and resistance to histoplasmosis. PMID: 24465479
  18. The LTB4-BLT signaling pathway provides a potent regulatory signal that accelerates the differentiation of mouse 3T3-L1 preadipocytes PMID: 23937951
  19. Data indicate that LTB4 receptor type 1 (BLT1)-knockout mice showed delayed liver repair and a 70-80% attenuation in expression of epidermal growth factor (EGF), vascular endothelial growth factor (VEGF), and VEGF receptor 1 (VEGFR1). PMID: 23629862
  20. These results suggest that BLT1 expression on CD8 T cells plays an important role in their trafficking to tumors. PMID: 23960231
  21. lipocalin OmCI ameliorates murine immune complex-induced acute lung injury in a process involving inhibition of LTB4 and C5 PMID: 23625922
  22. Absence of LTB4/BLT1 signal transduction in BLT1-null mice facilitates generation of GM-CSF-induced long-lasting antitumor immunologic memory by enhancing innate and adaptive immune systems. PMID: 22936657
  23. Signaling through its high-affinity G protein-coupled receptor leukotriene B4 receptor 1 (BLT1) directs dectin-1-dependent binding, ingestion, and cytokine production both in vitro and in vivo. PMID: 22696442
  24. Identify the importance of the LTB4-BLT1 pathway in the development of late-phase, allergen-induced airway responsiveness after secondary airway challenge in mice with established airway disease. PMID: 21421908
  25. a novel role of chemoattractant receptor, BLT-1, in promoting monocyte trafficking to adipose tissue and promoting chronic inflammation in obesity PMID: 21742977
  26. Catalytic activity of Cyp4fs is a novel target for modulating neuroinflammation through hydroxylation of LTB(4). PMID: 21466787
  27. Results identify LTB4-BLT1 as a potent nonchemokine pathway for cytotoxic effector cell traffic. PMID: 12949533
  28. the LTB4-BLT1 axis mediates neutrophil infiltration and secondary injury in experimental spinal cord injury PMID: 20304963
  29. Inflammation and bone erosion are absent in the knee joints of BLT1-deficient mice in an experimental arthritis model. PMID: 20656922
  30. Attenuated Th1 induction by dendritic cells from mice deficient in the leukotriene B4 receptor 1 PMID: 20004699
  31. BLT1 exacerbates experimental autoimmune encephalomyelitis by regulating the migration of inflammatory cells and T(H)1/T(H)17 immune responses. PMID: 20226760
  32. gammadelta T cell migration into the pleural cavity of mice during diverse inflammatory responses is dependent on LTB(4)/BLT1. PMID: 19880577
  33. bone resorption in was significantly attenuated in BLT1-deficient mice; furthermore, osteoclasts from BLT1-deficient mice showed reduced calcium resorption activities PMID: 19965376
  34. 351 amino acid sequence determined and aligned with human sequence PMID: 12895595
  35. The LTB4-BLT1 pathway is involved in linking early immune system activation and early effector T cell recruitment. PMID: 12949531
  36. PMN activation; survival; and MPO levels and bacterial levels in liver, lung , and peritoneal fluid were compared in BLT1(-/-) mice and WT mice PMID: 15358656
  37. BLT1 expression on primed T cells is required for the full development of airway hyperresponsiveness, which appears to be associated with IL-13 production in these cells. PMID: 15849325
  38. BLT1, but not BLT2, receptor mRNA was expressed in the DRG. The results suggest the expression of functional BLT1 receptors in the sensory neurons. PMID: 15950785
  39. model of acute lung rejection to demonstrate that BLT1 controls effector CD8+ T cell trafficking into the lung and that disruption of BLT1 signaling in CD8+ T cells reduces lung inflammation and mortality PMID: 15998790
  40. BLT1 mediates early recruitment of granulocytes into the airway in response to antigen-antibody interactions in a murine model of acute asthma. PMID: 16126787
  41. LTB4-BLT1 axis is required for the development of Th2-type immune response PMID: 16177061
  42. An important role is defined for mast cells and the LTB4-BLT1 receptor pathway in the development of CD8+ T cell-mediated allergic responses in the lung. PMID: 16493075
  43. expression of leukotriene b4 receptor is essential for development of airway hyperresponsiveness and inflammation through recruitment of IL-13 secreting CD8 positive T cells in mouse lung. PMID: 16522456
  44. BLT1 enables the recruitment of additional neutrophils not expressing this receptor, thereby amplifying the inflammatory response in autoantibody-induced arthritis. PMID: 16567386
  45. Disruption of BLT1 receptor is sufficient to offer complete protection of mice from developing arthritis in an inflammatory model. PMID: 16670336
  46. demonstrates expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells and a regulatory role for stem cell factor in their expression PMID: 16920986
  47. BLT1 contributes to the frequency and size of abdominal aortic aneurysms in mice. PMID: 17579092
  48. Ser-127-Ala substitution of the PKC consensus phosphorylation site on the second intracellular loop prevented the BLT1 desensitisation. PMID: 17595524
  49. LTB4/BLT1 pathway mediates hepatic microcirculatory dysfunction by enhanced expression of ICAM-1 and TNF-[alpha] in a murine model of endotoxemia. PMID: 18004232
  50. BLT1 expression on dendritic cells (DCs) is required for migration of DCs to regional lymph nodes as well as in the development of airway hyperresponsivness and airway inflammation. PMID: 18606670

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed on activated leukocytes, including eosinophils.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1