Recombinant Mouse Lymphotoxin-beta (Ltb)

Code CSB-CF013220MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ltb; Tnfc; Tnfsf3; Lymphotoxin-beta; LT-beta; Tumor necrosis factor C; TNF-C; Tumor necrosis factor ligand superfamily member 3
Species
Mus musculus (Mouse)
Expression Region
1-306
Target Protein Sequence
MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRRVEKIIGSGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASAWMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLRSGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSPELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFFGAVMVG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface.
Gene References into Functions
  1. The expression of lymphotoxin (LT)-B was significantly downregulated in the absence of T cells from nude mice and was recovered after the transfusion of T cells. PMID: 25266629
  2. TNF is able to upregulate LT-beta expression in hepatic cells at the transcriptional level by the binding of NF-kappaB p50/p65 heterodimers and Ets1 to their respective sites in the LT-beta promoter. PMID: 22742857
  3. Lymphotoxin-beta-receptor (LTbetaR) signaling, a pathway essential for lymphoid organogenesis, abrogates tertiary lymphoid organ development in heart transplantation. PMID: 21926237
  4. LTbeta RNA is detectable in embryos ranging from 5.5 to 18.5 days of development, e.g., in peripheral lymph nodes, Peyer's patches, thymus and skin of the E18.5 embryo and fetal liver of E12.5. PMID: 11994460
  5. membrane lymphotoxin beta contributes to anti-leishmanial immunity by controlling structural integrity of lymphoid organs PMID: 12115620
  6. The organogenic function of B-LTbeta is almost entirely restricted to spleen, where it supports the correct lymphoid architecture that is critical for an effective humoral immune response. PMID: 12354378
  7. microenvironment in peripheral lymphoid organs associated with lymphotoxin alpha/lymphotoxin beta-lymphotoxin beta receptor signaling and chemokine production is critical for recruitment efficiency of dendritic cel PMID: 12560241
  8. membrane LT-beta is important in resistance to Theiler's virus infection PMID: 12882833
  9. Lymphotoxin-mediated adhesion molecule expression may be important in the development of graft-versus-host skin disease. PMID: 14734744
  10. LTbeta, LTbeta receptor, and IFNgamma are involved in oval cell-mediated, but not hepatocyte-mediated, liver regeneration, and the absence of these pathways impairs the oval cell-dependent regenerative response. PMID: 15660390
  11. The lymphotoxin beta signaling pathway is an essential effector pathway for host defense against the beta-herpesvirus muromegalovirus (MCMV). PMID: 15905567
  12. Data show that, as an ectodysplasin target, lymphotoxin-beta regulates hair phenotype in developing hair follicles. PMID: 16738056
  13. Expression of LTbeta on lymphocytes enhances the induction of immune responses against limiting amounts of antigen PMID: 16841297
  14. Expression of lymphotoxin-alphabeta on antigen-specific T cells is required for DC function. PMID: 17452522
  15. Activation of LTbetaR by LTalphabeta mainly expressed on T lymphocytes is crucial for the down regulation of the inflammatory response in this experimental model. PMID: 17590442
  16. LTbeta shows a primary early function in periderm differentiation, with later transient effects on epidermal and hair follicle differentiation. PMID: 17673451
  17. signal was essential for primary B cell cluster formation with initial differentiation of follicular dendritic cells (FDCs) in neonatal mice. PMID: 17982070
  18. LTbetaR on hepatic stellate cells may be involved in signaling with LTbeta-expressing liver progenitor cells mediating recruitment of progenitor cells, hepatic stellate cells, & leukocytes for wound healing & regeneration during chronic liver injury. PMID: 19111021

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1