Recombinant Mouse Melanopsin (Opn4)

Code CSB-CF879449MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Opn4
Uniprot No.
Alternative Names
Opn4; Mop; Mopn; Melanopsin; Opsin-4
Species
Mus musculus (Mouse)
Expression Region
1-521
Target Protein Sequence
MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFP TVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSV TQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGR GSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFC FVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVIL LFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQ HLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGRKRQESLGSESEVGWTDT ETTAAWGAAQQASGQSFCSQNLEDGELKASSSPQVQRSKTPKVPGPSTCRPMKGQGARPS SLRGDQKGRLAVCTGLSECPHPHTSQFPLAFLEDDVTLRHL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Photoreceptor that binds cis-retinaldehydes. Contributes to pupillar reflex, photoentrainment and other non-image forming responses to light. May be involved in the optokinetic visual tracking response. May be involved in the regulation of retinal hyaloid vessel growth and regression.
Gene References into Functions
  1. we show that OPN2 and OPN4 participate in immediate pigment darkening induced by UVA in murine normal and malignant melanocytes through a conserved common pathway PMID: 29395480
  2. Data from mouse model reveal a distinct melanopsin contribution to encoding visual images, predicting that, under natural view, melanopsin augments the early visual system's ability to encode patterns over moderate spatial scales. PMID: 28528909
  3. A subset of M1 and M1d melanopsin ganglion cells are biplexiform with dendrites ramifying both in the inner plexiform layer and either in the inner plexiform layer or the outer plexiform layer. We have found five types of Outer Retinal Dendritess in the OPL categorized by their morphology and the melanopsin ganglion cell subtype from which they originate. PMID: 28758193
  4. our results highlight how the kinetics of the melanopsin photoresponse differentially regulate distinct light-mediated behaviors. PMID: 28223508
  5. Melanopsin contributes to irradiance modulation of narrowband oscillations in the retina and dorsal lateral geniculate nucleus. PMID: 28103478
  6. discovery that amino acid sequence features of melanopsin protein contribute to the functional properties of the intrinsically photosensitive retinal ganglion cells PMID: 27181062
  7. When compared with wildtype responses, sleep onset in melanopsin (OPN4-/-) mice was significantly advanced under blue light, whereas under violet and green light it was significantly delayed. PMID: 27276063
  8. Melanopsin overexpression in RGCs enhanced the amplitude and duration of their light response, and silencing them with Kir2.1 significantly suppressed the increased mTOR signaling and axon regeneration that were induced by melanopsin PMID: 26831088
  9. mice null for melanopsin (Opn4-/-), lost significantly more weight than wild-type controls or mice lacking rod and cone photoreceptors. PMID: 26011287
  10. These results suggest GRK2 contributes to melanopsin deactivation, but that other mechanisms account for most of modulation of melanopsin activity in ipRGCs. PMID: 26069965
  11. Using a combination of conventional knockout, chemogenetic, and receptor-silent substitution manipulations, we continued to show that, over higher irradiances, this increase in firing originates with inner-retinal melanopsin photoreception PMID: 26438865
  12. Opn4 mediates wavelength-specific, light-dependent vascular relaxation. PMID: 25404319
  13. Data indicate that retinal molecular circadian clock can be entrained by lighting cycles in vitro, but that rods, cones, and melanopsin (Opn4) are not required for this entrainment. PMID: 24843129
  14. critical phosphorylation sites on the carboxy tail of melanopsin PMID: 24678795
  15. Melanopsin Is required for normal Sensitivity and expression in alpha retinal ganglion cells. PMID: 24853938
  16. the role of melanopsin-expressing retinal ganglion cells in the glaucoma-induced depressive behavioral response pattern was investigated PMID: 23729182
  17. melanopsin is important for initiation and maintenance of light-induced sleep during the dark phase. PMID: 23510299
  18. The attenuation of the melanopsin-based light response by dopamine is mediated by direct PKA phosphorylation of melanopsin. PMID: 23049792
  19. when mice are mutated in the gene (Opn4) for the atypical opsin melanopsin, or are dark-reared from late gestation, the hyaloid vessels are persistent at 8 days post-partum and the retinal vasculature overgrows PMID: 23334418
  20. The sustained-type light response of retinal dopamine neurons requires melanopsin. PMID: 22880066
  21. UV light exposure induces sleep in wild-type and melanopsin-deficient (Opn4(-/-)) mice with equal efficacy. PMID: 22771039
  22. molecular properties of melanopsin PMID: 22670683
  23. a model in which retinal is continuously covalently bound to melanopsin and may function through a reversible, bistable mechanism PMID: 22547062
  24. Opn4S mRNA was detected at relatively constant levels throughout postnatal development, with levels of Opn4S protein showing a marked increase between P0 and P3. Levels of Opn4L mRNA and protein were low at birth and markedlyd increased at P14 and P3. PMID: 22496826
  25. Melanopsin increase might have been induced by either a maternal or a developmental signal and is likely related to the first connections between the retina and the suprachiasmatic nucleus. PMID: 21925644
  26. heterologously expressed melanopsin is phosphorylated in a light-dependent manner, and this phosphorylation is involved in regulating the rate of G-protein activation and the lifetime of melanopsin's active state PMID: 22159583
  27. In mouse, this intrinsic pupillary light reflex requires the visual pigment melanopsin; it also requires PLCbeta4, a vertebrate homologue of the Drosophila NorpA phospholipase C which mediates rhabdomeric phototransduction. PMID: 22051675
  28. Light prolongs spiking during the waves and enhances the segregation of retinogeniculate afferents, and that it did so by activating melanopsin-expressing, intrinsically photosensitive retinal ganglion cells. PMID: 21642974
  29. Approximately 2% of retinal ganglion cells are intrinsically photosensitive express melanopsin and are necessary for light to modulate specific physiological processes in mice PMID: 21418557
  30. Data show that visual responses in TKO mice extend beyond the retina to encompass the lateral margins of the lateral geniculate nucleus and components of the visual cortex. PMID: 21124780
  31. Findings have significant implications for the understanding of how melanopsin signalling may modulate aversive responses to light. PMID: 21124784
  32. The study data establish melanopsin-based photoreception as a significant source of sensory input to the thalamo-cortical visual system, providing unique irradiance information and allowing visual responses to be retained even in absence of rods+cones. PMID: 21151887
  33. These results strongly suggest that light activation of melanopsin in intrinsically photosensitive retinal ganglion cells may regulate physiological functions such as sleep/wake cycles in preterm and neonatal infants. PMID: 20855606
  34. First time evidence is presented which demonstrates intraretinal ion regulation by melanopsin in vivo. PMID: 20808732
  35. Periods of darkness or, more likely, the sequence of light and dark periods occurring under the daily cycles might be necessary for the normal development of the melanopsin system PMID: 20435589
  36. the results of this study indicated that melanopsin-based phototransduction supports pattern vision in the absence of functioning rod and cone photoreceptors. PMID: 20624591
  37. the retina maintains a rather constant number of melanopsin-expressing retinal ganglion cells from the first postnatal day PMID: 19924643
  38. melanopsin containing retinal ganglion cell axons project to the suprachiasmatic nucleus and other brain nuclei involved in circadian photoentrainment or the pupillary light reflex PMID: 11834834
  39. melanopsin is not essential for the circadian clock to receive photic input, but it contributes significantly to the magnitude of photic responses PMID: 12481140
  40. critical role in circadian photoentrainment PMID: 12481141
  41. the diminished pupillary light reflex at high irradiances in melanopsin-knockout mice suggests that the melanopsin-associated system and the classical rod/cone system are complementary in function PMID: 12522249
  42. First positive correlation between the persistence of melanopsin-expressing cells and the maintenance of both circadian and pupillary responses to light in the absence of rods and cones. PMID: 12752778
  43. required for nonvisual photoreception in blind mice PMID: 12829787
  44. Melanopsin forms a photopigment capable of activating a G-protein, but its spectral properties are not consistent with the action spectrum for circadian entrainment. PMID: 14596587
  45. Results suggest that melanopsin in retinal ganglion cells is involved in masking, as it is in pupil contraction and phase shifts. PMID: 14680139
  46. Melanopsin expression is not confined to these photosensitive retinal ganglion cells, but is also expressed in the retinal pigment epithelium, a tissue with no known photosensensory role. PMID: 15046875
  47. melanopsin is a functional sensory photopigment, it is the photopigment of ganglion-cell photoreceptors, and these photoreceptors may use an invertebrate-like phototransduction cascade PMID: 15674243
  48. expression in Xenopus oocytes results in light-dependent activation of membrane currents through the Galpha(q)/Galpha(11)G protein pathway, with an action spectrum closely matching melanopsin-expressing intrinsically photosensitive retinal ganglion cells PMID: 15681390
  49. photosensitive retinal ganglion cells are light responsive from birth and that this photosensitivity requires melanopsin expression. PMID: 15964274
  50. Melanopsin is the photopigment in intrinsically photosensitive retinal ganglion cells. PMID: 16014418

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cell projection, dendrite. Perikaryon.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity
Expressed in the retinal pigment epithelium and ganglion cell layer (at protein level). Also expressed in amacrine cell layers of the retina. Weakly expressed in vibrissae, and tail.; [Isoform 1]: Observed with processes in the outer strata of inner plexi
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1