Recombinant Mouse Occludin (Ocln)

Code CSB-CF016263MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ocln; Ocl; Occludin
Species
Mus musculus (Mouse)
Expression Region
1-521
Target Protein Sequence
MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLFGGSLNYPYSGFGYGGGYGGGYG GYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLIVIIVSAIL GIMVFIATIVYIMGVNPTAQASGSMYGSQIYMICNQFYTPGGTGLYVDQYLYHYCVVDPQ EAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVS AGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPESFYKSTPLVPEVAQEIPLTLSVD DFRQPRYSSNGNLETPSKRAPTKGKAGKGKRTDPDHYETDYTTGGESCEELEEDWVREYP PITSDQQRQLYKRNFDAGLQEYKSLQAELDDVNKELSRLDKELDDYREESEEYMAAADEY NRLKQVKGSADYKSKRNYCKQLKSKLSHIKRMVGDYDRRKP
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier.
Gene References into Functions
  1. PLD2 is pivotal in the regulation of the integrity of epithelial tight junctions and occludin turn over, thereby implicating it in the pathogenesis of colitis. PMID: 28484281
  2. Adherens as well as tight junction marker proteins were rapidly and consistently upregulated in both the germinal as well as the functional layer of the oral mucosa. This represents a previously unknown parameter of the epithelial radiation response to clinically relevant fractionation protocols. CONCLUSION: Fractionated irradiation significantly enhanced the expression of all proteins investigated. This study revealed a PMID: 29675597
  3. The C-terminal DSP domain induced phosphorylation of occludin Ser(490) and focal adhesion kinase (FAK) Ser(722) and Tyr(576). Coexpression of DSP, occludin and FAK was detected in dental mesenchymal cells during tooth development. Occludin physically interacts with FAK, and occludin and FAK phosphorylation can be blocked by DSP and occludin antibodies. PMID: 28331230
  4. Endothelial cellsTLR4 strongly regulates retinal vessel permeability by reducing expression of occludin and zonula occludens 1. PMID: 29136627
  5. The zinc sensing receptor, ZnR/GPR39, triggers intracellular Ca(2+) signalling in colonocytes thereby inducing occludin expression. Moreover, ZnR/GPR39 is essential for epithelial barrier recovery in the dextran sodium sulfate (DSS) ulcerative colitis model. PMID: 27377730
  6. Occludin expression by epidermal gammadelta T cells upon activation in response to epidermal stress allows them to move, which could be important for augmentation of immune responses via collaboration with other cells. PMID: 28566372
  7. Intracellular zinc has an essential role in the maintenance of the intestinal epithelial tight junction barrier through regulation of occludin proteolysis and claudin-3 transcription. PMID: 27151944
  8. miR-429 could down-regulate the expression of Ocln by targeting the Ocln 3'-UTR, which impaired intestinal barrier function in diabetes mellitus mice. PMID: 27299781
  9. STAT3 activation downregulates the ZO-1 and occludin levels and increases the endothelial permeability through the induction of VEGF production in retinal endothelial cells. PMID: 27580405
  10. Tricellulin is a specific redox sensor and sealing element at 3-cell contacts and may compensate as a redox mediator for occludin loss at 2-cell contacts in vivo and in vitro. PMID: 25919114
  11. These findings provide evidence for occludin playing a role in the invasion of Toxoplasma gondii in small intestinal epithelial cells. PMID: 26183539
  12. occludin deficiency increases susceptibility to ethanol-induced colonic mucosal barrier dysfunction and liver damage in mice. PMID: 26721332
  13. PHD3 protects intestinal epithelial barrier function and reveal a hydroxylase-independent function of PHD3 in stabilizing occludin PMID: 26124271
  14. Zonula occludens-1, occludin and E-cadherin expression and organization in salivary glands PMID: 25248927
  15. Our study demonstrates spatiotemporal alterations in occludin mRNA- and protein-expression, indicating that Cx43 might act as a regulator for blood-testis-barrier PMID: 24497041
  16. Occludin and Claudin-1 expressions in the large intestine are under the circadian control, which is associated with temporal regulation of colonic permeability and also susceptibility to colitis. PMID: 24845399
  17. Hypoxic induction of CAV1 in the colon was essential for intestinal barrier integrity by regulating occludin expression. PMID: 24891620
  18. Activation of RhoA/ROCK1 by high glucose in diabetic nephropathy disrupts the expression and translocation of occludin/ZO-1, which can be corrected by simvastatin. PMID: 24244596
  19. Similar levels of occludin gene expression were detected. PMID: 23568966
  20. actin cytoskeletal dynamics is detrimental to METH-induced BBB dysfunction by increasing internalization of occludin. PMID: 24081143
  21. Occludin showed identical mRNA expression levels in the brains of adult and aged mice. PMID: 22120415
  22. occludin KO gammadelta T cells are defective in both initial accumulation and migration within the intraepithelial compartment PMID: 22511722
  23. show that murine OCLN can sustain HCVcc entry, albeit with about 5-fold reduced efficiency compared to that of human OCLN PMID: 21632765
  24. Suggest occludin plays a crucial role in the maintenance of tight junction barrier through the large-channel TJ pathway, the pathway responsible for the macromolecule flux. PMID: 21415414
  25. The distribution patterns of tight junctions in ameloblasts by observing the expression patterns of OLD and CLDs (CLD-1 to CLD-10), were examined. PMID: 20683698
  26. The tight junction protein occludin (encoded by the OCLN gene) is involved in the pathogenesis of malformations of cortical development. PMID: 20727516
  27. Nedd4-2 interacts with occludin to inhibit tight junction assembly and the regulation of paracellular conductance in the collecting duct. PMID: 20504882
  28. marvelD3, occludin, and tricellulin define the tight junction-associated MARVEL protein family PMID: 20164257
  29. in vivo imaging and transgenic mice expressing fluorescent-tagged occludin and ZO-1 fusion proteins to link occludin endocytosis to TNF-induced tight junction regulation. PMID: 20351069
  30. suggest that occludin has a protective as well as a barrier forming role in epithelia. PMID: 20003227
  31. Surface plasmon resonance study of interaction of occludin with ZO-1 PMID: 11700038
  32. E-cadherin and claudins/occludin have roles in the regulation of tight junctions during the epithelium-mesenchyme transition, but are repressed by snail PMID: 12668723
  33. Data show that occludin is involved in establishing the blastocoel, in maintaining its impermeability, and that the development of tight junctions is critical for trophectoderm formation in mouse embryos. PMID: 15179038
  34. common molecular mechanism of forming a helical bundle between the hinge region/GuK domain of ZO-1 and alpha-catenin and occludin is identified as a general molecular principle organizing the association of ZO-1 at adherens and tight junctions PMID: 15548514
  35. Loss of occludin expression is at least partially involved in the senescence-escape program during mammary tumorigenesis. PMID: 17459053
  36. Amyotrophic lateral sclerosis-linked superoxide dismutase 1 (SOD1) mutants with different biochemical characteristics disrupted the blood-spinal cord barrier in mice by reducing the levels of the tight junction protein occludin. PMID: 18344992
  37. Describe method to study the intracellular transport of occludin to and from the cell surface in both fibroblasts and epithelial cells. PMID: 18369939
  38. In mouse cerebral cortex, microinjection of VEGF-A disrupted CLN-5 and OCLN and induced loss of barrier function PMID: 19174516
  39. the pro-inflammatory chemokine CCL2 mediates brain endothelial barrier disruption during CNS inflammation PMID: 19423710
  40. The oligomerization of the coiled coil-domain of occluddin is redox sensitive PMID: 19538283
  41. Disruptions of occludin and claudin-5 in brain endothelial cells in vitro and in brains of mice with acute liver failure. PMID: 19821483

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Protein Families
ELL/occludin family
Tissue Specificity
Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in the testis, kidney, lung, liver and brain. Not detected in skeletal muscle, spleen and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×