Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-MP018146MO |
| Size | |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Target Names | Pld3 |
| Uniprot No. | O35405 |
| Research Area | Others |
| Alternative Names | Pld3; Sam9; 5'-3' exonuclease PLD3; Choline phosphatase 3; Phosphatidylcholine-hydrolyzing phospholipase D3; Phospholipase D3; PLD 3; Schwannoma-associated protein 9; SAM-9 |
| Species | Mus musculus (Mouse) |
| Source | Mammalian cell |
| Expression Region | 1-488aa |
| Target Protein Sequence | MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLRDWESPYSHDLDTSANSVGNACRLL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Tag Info |
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it’s possible to develop. |
| Form |
Lyophilized powder Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged. |
| Buffer | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
5'->3' DNA exonuclease which digests single-stranded DNA (ssDNA). Regulates inflammatory cytokine responses via the degradation of nucleic acids, by reducing the concentration of ssDNA able to stimulate TLR9, a nucleotide-sensing receptor in collaboration with PLD4. May be important in myotube formation. Plays a role in lysosomal homeostasis. Involved in the regulation of endosomal protein sorting.
|
| Gene References into Functions |
|
| Subcellular Location | Endoplasmic reticulum membrane; Single-pass type II membrane protein. Lysosome lumen. Early endosome membrane; Single-pass type II membrane protein. Late endosome membrane; Single-pass type II membrane protein. Golgi apparatus membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein. |
| Protein Families | Phospholipase D family |
| Tissue Specificity | Expressed at higher level in brain than in non-nervous tissue. Expressed in mature neurons of the forebrain and appears to be turned on at late stages of neurogenesis. Expressed during late neuronal development in the forebrain. Expressed in the pyramidal |
| Database Links |
KEGG: mmu:18807 STRING: 10090.ENSMUSP00000112942 UniGene: Mm.6483 |
