Recombinant Mouse Phospholipase D3(Pld3)

Code CSB-CF018146MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O35405
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-CF018146MO could indicate that this peptide derived from E.coli-expressed Recombinant Mouse Phospholipase D3(Pld3) Pld3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-CF018146MO could indicate that this peptide derived from E.coli-expressed Recombinant Mouse Phospholipase D3(Pld3) Pld3.
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLRDWESPYSHDLDTSANSVGNACRLL
Research Area Others
Source in vitro E.coli expression system
Gene Names Pld3
Protein Names Recommended name: Phospholipase D3 Short name= PLD 3 EC= 3.1.4.4 Alternative name(s): Choline phosphatase 3 Phosphatidylcholine-hydrolyzing phospholipase D3 Schwannoma-associated protein 9 Short name= SAM-9
Expression Region 1-488aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 58.2 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in APP processing.
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Phospholipase D family
Tissue Specificity Expressed at higher level in brain than in non-nervous tissue. Probably highly expressed in neurons. Expressed in mature neurons of the forebrain and appears to be turned on at late stages of neurogenesis. Expressed during late neuronal development in the
Database Links

KEGG: mmu:18807

STRING: 10090.ENSMUSP00000112942

UniGene: Mm.6483

Related Products

Pld3 Proteins

Pld3 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.