Recombinant Mouse Probable G-protein coupled receptor 45(Gpr45)

Code CSB-CF863649MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9EQQ4
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MACNSTPMGTYEHLLLNVSNTLDPGDTPLSAPLRISLAIMMLLMIVVGFLGNTVVCIIVY QRPAMRSAINLLLATLAFSDIMLSLCCMPFTAITLITVRWHFGDHFCRLSATLYWFFVLE GVAILLIISVDRFLIIVQRQDKLNPRRAKMIIAASWVLSFCISAPSFTGWTFMEVPARAP QCVLGYTEFPAERAYVVTLVVAVFFAPFGVMLCSYLCILNTVRKNAVRVHNQSDSLDLRQ LTGAGLRRLRRQQQQASLDLSFKTKAFTTILILFVGFSLCWLPHSVYSLLSAFSRRFYYS ASFYTTSTCVLWLSYLKSVFNPIVYCWRIKKFREACIELLPHTFQILPKVPERIQRKIQP STIYVCNENQSAV
Source in vitro E.coli expression system
Gene Names Gpr45
Protein Names Recommended name: Probable G-protein coupled receptor 45 Alternative name(s): PSP24-1 PSP24-alpha
Expression Region 1-373
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Orphan receptor. May play a role in brain function.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Brain specific.
Database Links

KEGG: mmu:93690

STRING: 10090.ENSMUSP00000110409

UniGene: Mm.444976

Related Products

Gpr45 Proteins

Gpr45 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.