Recombinant Mouse Prostacyclin receptor (Ptgir)

Code CSB-CF018981MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ptgir; Prostacyclin receptor; Prostaglandin I2 receptor; PGI receptor; PGI2 receptor; Prostanoid IP receptor
Species
Mus musculus (Mouse)
Expression Region
1-412
Target Protein Sequence
MMASDGHPGPPSVTPGSPLSAGGREWQGMAGSCWNITYVQDSVGPATSTLMFVAGVVGNG LALGILGARRRSHPSAFAVLVTGLAVTDLLGTCFLSPAVFVAYARNSSLLGLAHGGTMLC DTFAFAMTFFGLASTLILFAMAVERCLALSHPYLYAQLDGPRCARFALPSIYAFCCLFCS LPLLGLGEHQQYCPGSWCFIRMRSAQPGGCAFSLAYASLMALLVTSIFFCNGSVTLSLYH MYRQQRRHHGSFVPTSRAREDEVYHLILLALMTVIMAVCSLPLMIRGFTQAIAPDSREMG DLLAFRFNAFNPILDPWVFILFRKAVFQRLKFWLCCLCARSVHGDLQAPLSRPASGRRDP PAPTSLQAKEGSWVPLSSWGTGQVAPLTAVPLTGGDGCSVGMPSKSEAIAAC
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for prostacyclin (prostaglandin I2 or PGI2). The activity of this receptor is mediated by G(s) proteins which activate adenylate cyclase.
Gene References into Functions
  1. results provide evidence that PGI2/IP signaling suppresses the STAT6-independent pathway of allergic airway inflammation PMID: 27456482
  2. Data (including data from studies using transgenic mice, an murine experimental model of diabetes, and mouse/human cell lines) suggest prostaglandin I2 receptor (Ptgir) is involved in insulin secretion in pancreatic beta-cells and in permselectivity in glomerular podocytes; the mechanism appears to involve regulation of post-translational phosphorylation of nephrin. PMID: 26868296
  3. Deletion of the I prostanoid receptor had no effect on the attenuation of atherogenesis by mPGES-1 deletion in the low-density lipoprotein receptor knockout mice. PMID: 27440004
  4. Prostacyclin promotes the up-regulation of Nox4 in endothelial cells, which opens up a novel strategy that protects and enhances endothelial cell functions in cardiovascular disease, such as repair after myocardial infarction or other ischemic conditions. PMID: 24450852
  5. Its signaling increase cAMP concentration, which prototes sysnesis of HGF, causing angiogenesis. PMID: 24292413
  6. an essential role of the COX-2/PGI2 receptor axis in the cardioprotection afforded by the late ischemic preconditioning PMID: 22844439
  7. findings suggest the IP receptor might maintain an angiogenic switch in the "on" state in tumor endothelial cells (TEC); suggest that the IP receptor is a TEC-specific marker and might be a useful therapeutic target PMID: 22380928
  8. PGI2-induced PPAR delta activation accelerates blastocyst hatching in mice PMID: 21511721
  9. For the first time these results show that activation of prostaglandin I2 receptor can attenuate damage following cerebral ischemia. PMID: 20621166
  10. identify PGI(2)-prostaglandin I2 receptor as an important pathway for inhibiting allergic pulmonary inflammation by controlling recruitment of CD4(+) Th2 cells into the inflammatory site PMID: 17947695
  11. The prostacyclin/IP pathway suppresses cardiac fibrosis, at least partly, by inducing CREB phosphorylation. PMID: 20403362
  12. Prostaglandin I2 receptor signaling promotes T helper cell type (Th)1 differentiation through a cyclic adenosine monophosphate (AMP)-protein kinase A pathway, thereby initiating acquired cutaneous immune responses. PMID: 20400695
  13. The prostaglandin I(2)-IP system is essential for EPCs to accomplish their function and plays a critical role in the regulation of vascular remodeling. PMID: 20007911
  14. Results identify the cyclooxygenase-2 gene as a target of APOE signaling, link HDL and APOE to prostacyclin receptor IP action, and describe a potential new basis for the cardioprotective effect of HDL and APOE. PMID: 14966570
  15. results suggest that signaling through IP has antiviral effects while protecting against respiratory syncytial virus-induced illness PMID: 15367596
  16. The -CSLC motif of the IP is a direct target for inhibition by the FTI SCH66336, and in the presence of strong farnesyltransferase inhibition, the IP does not undergo compensatory geranylgeranylation. PMID: 15469414
  17. Baseline systolic blood pressurewas significantly lower in the IP(-/-) group than in the IP(+/+) mice. PMID: 15635218
  18. IP plays a suppressive role in the development of pressure overload-induced cardiac hypertrophy via the inhibition of both cardiomyocyte hypertrophy and cardiac fibrosis PMID: 15983244
  19. IP receptors play an important role in preimplantation embryo development and mediate the embryo's response to exogenous PGI(2) PMID: 17905746
  20. ONO-54918-07 mimics the effect of PGE1(prostaglandin E1), supporting the notion that the PGE1 effect on NG108-15 cells is mediated by prostacyclin receptors. PMID: 17952410
  21. prostacyclin receptor knockout mice showed normal pain behavior in all tests PMID: 18938093
  22. PGIS/ IP transgenic animals with lung-specific PPARgamma overexpression also developed fewer lung tumors. PMID: 19138979

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1