Recombinant Mouse Syndecan-4 (Sdc4)

Code CSB-CF020891MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Sdc4
Uniprot No.
Alternative Names
Sdc4; Syndecan-4; SYND4; Ryudocan core protein
Species
Mus musculus (Mouse)
Expression Region
24-198
Target Protein Sequence
ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP.
Gene References into Functions
  1. SDC4 antagonizes the activation of RIG-I in a CYLD-mediated deubiquitination-dependent process, thereby balancing antiviral signalling to avoid deleterious effects on host cells. PMID: 27279133
  2. Cell-extracellular matrix and cell-cell adhesion are linked by syndecan-4. PMID: 27751945
  3. Syndecan-4 is essential for the compensated hypertrophy and the maintenance of cardiac function during the process of heart failure following pressure overload. PMID: 28395201
  4. This study demonstrates that the shedding of synd4 from Endothelial progenitor cells (EPCs) plays a key role in advanced glycation end products-mediated dysfunction of EPC migration and homing. PMID: 27662820
  5. Syndecan-4 therapy also induces a marked immunomodulation in the tissues, increasing the polarization of macrophages toward the M2 phenotype. PMID: 26891081
  6. SDC4 thus controls flow-induced lymphatic endothelial cell polarization via regulation of VANGL2 expression. PMID: 27789626
  7. loss of N-sulfation leads to the disruption of the pattern of distribution of Sdc-4 within the glomeruli of Ndst1-/- mutants PMID: 26936875
  8. Sdc4 has been identified as a mycobacterial attachment receptor on alveolar epithelial cells. PMID: 27279134
  9. Synd4 shedding from vascular endothelial cells played an important role in the diabetes-related impairment of angiogenesis. PMID: 27018253
  10. the present study demonstrated that synd4 was involved in the chemotactic migration of ECs in vitro and in vivo. PMID: 27541034
  11. Shedding of syndecan-4 promotes immune cell recruitment and mitigates cardiac dysfunction after lipopolysaccharide challenge in mice. PMID: 26449522
  12. SDC4 plays an important role in asthma induction. Disturbed SDC4 signalling leads to an impaired motility and directional migration of antigen-presenting dendritic cells. PMID: 26165408
  13. Syndecan-4 exerts a dual role in collagen cross-linking, one involving its cytosolic domain and calcineurin/nuclear factor of activated T-cells signalling leading to collagen PMID: 25587045
  14. Locally generated Sdc4 may play a role in regulating TRPC6 channels, and may contribute to glomerular pathology. PMID: 26193076
  15. Sdc4 contributes to the development of collagen induced arthritis by promoting germinal center formation and autoantibody production through its regulation of SDF-1-mediated B cell migration. PMID: 25989265
  16. binding interaction between syndesmos and syn4(cyto) was characterized as a low-affinity interaction (Kd = 62 muM) by surface plasmon resonance and nuclear magnetic resonance PMID: 26100207
  17. the crucial role of SDC-4 for neuron density, neurite length, and branches. PMID: 25757361
  18. SDC4 participates in amelogenesis, and FGF10 may modulate dental epithelial cell behaviors through the regulation of SDC4 expression. PMID: 25174688
  19. Data show that endothelial cells (ECs) from the thoracic aortas of syndecan 4 (S4-/-) mice were poorly aligned in the direction of the flow. PMID: 25404299
  20. Sdc4 is required for cell surface targeting of transglutaminase 2 and the development of kidney fibrosis in chronic kidney disease. PMID: 24357671
  21. The results indicate that syndecan-4 may play an important role in beta-cell function and that the cell-surface HS proteoglycans may be the missing link to maintaining islet longevity after isolation. PMID: 22872317
  22. Results indicate that the DC-HIL/syndecan-4 (SD-4) pathway regulates autoimmune responses by mediating the T cell suppressor function of myeloid-derived suppressor cells (MDSCs). PMID: 24516197
  23. Angiopoietin-2 secretion by endothelial cell exosomes: regulation by the phosphatidylinositol 3-kinase (PI3K)/Akt/endothelial nitric oxide synthase (eNOS) and syndecan-4/syntenin pathways. PMID: 24235146
  24. Sdc4 has a dynamic expression pattern during development and is detected in tissues, including the neural tube during and following closure, the hindgut and the cochlea. Co-expression with Vangl2 is consistent with a possible role for Sdc4 in Wnt/PCP signaling during morphogenesis. PMID: 23760952
  25. PGE2-induced activation of angiogenesis is mediated via syndecan-4-dependent activation of PKCalpha. PMID: 23525101
  26. syndecan-4 is important for the differentiation of cardiac fibroblasts into myofibroblasts in the pressure-overloaded heart. PMID: 23178899
  27. A deletion or knockdown of the Syndecan 4 effector molecule PKCalpha led to a similar reduction in phosphorylation of Thr308 while overexpression of myristoylated PKCalpha rescued AktThr308 phosphorylation in endothelial cells lacking Syndecan 4. PMID: 22975683
  28. Alpha-actinin interaction with syndecan-4 has a role in stabilising cell-matrix adhesion. PMID: 22940199
  29. Our results demonstrate that syndecan 4 is functionally involved in endochondral ossification and that its loss impairs fracture healing, due to inhibition of compensatory mechanisms under inflammatory conditions. PMID: 23233348
  30. Arf6 is responsible for alpha5beta1-integrin recycling and thereby completes the cycle of syndecan-4-regulated integrin trafficking. PMID: 22790193
  31. SD-4, as the T-cell ligand of DC-HIL, is a potent inhibitor of allo-reactive T cells responsible for GVHD and a potentially useful target for treating this disease. PMID: 23113638
  32. Macrophages and epithelial cells treated with LPS had increased expression of syndecan-4. PMID: 22427536
  33. Reduced Syndecan-4 is associated with severe colitis in IL-10 knockout mice. PMID: 21987406
  34. Syndecan-4 is essential for development of concentric myocardial hypertrophy via stretch-induced activation of the calcineurin-NFAT pathway PMID: 22164265
  35. The proteoglycan syndecan 4 regulates transient receptor potential canonical 6 channels via RhoA/Rho-associated protein kinase signaling in glomerular permeability. PMID: 22155451
  36. Interception of the Sdc4 pathway enhances infarct expansion and hypertrophic remodelling during early infarct healing in ischaemic-reperfusion injury. PMID: 21632883
  37. Disruption of syndecan-4 or caveolin, gene disruption of RhoG in mice was found to retard closure of dermal wounds due to a migration defect of the fibroblasts and keratinocytes of RhoG null mice. PMID: 21982645
  38. inhibits T-cell activation by employing CD148 protein tyrosine phosphatase activity PMID: 21469128
  39. Syn4 plays an important role in the inflammatory response and granulation tissue formation, thereby preventing cardiac rupture and dysfunction after myocardial infarct PMID: 21493899
  40. Syn4 deficiency limits neointimal formation after vascular injury by regulating vascular smooth muscle cell proliferation and vascular progenitor cell mobilization. PMID: 21330609
  41. A new houttuyfonate derivative can inhibit the proliferation of NIH3T3 cell and the expression of syndecan-4 protein induced by TNF-alpha in vitro. PMID: 20518314
  42. RGD-independent cell adhesion via a tissue transglutaminase 2-fibronectin matrix promotes fibronectin fibril deposition and requires syndecan-4/2 and {alpha}5{beta}1 integrin co-signaling. PMID: 20929862
  43. Loss of syndecan-4 do not organize alpha-smooth muscle actin into bundles. PMID: 20154082
  44. demonstrate the ability of syndecan-4 molecules to support cell attachment and spreading without the direct extracellular binding of integrins PMID: 20080785
  45. Syndecan4 has a role in regulation of microvascular homeostasis by carrying heparan sulfate PMID: 12074629
  46. role of syndecan-4 in focal adhesion kinase phosphorylation PMID: 12087088
  47. Syndecan-4 mRNA transcripts are expressed by reactive astrocytes in the region surrounding the necrotic brain tissue, exhibiting peak levels at day 7 after cryo-injury. PMID: 12112370
  48. enhanced syndecan-4 expression in mouse cardiac endothelial cells results in preferential augmentation of fibroblast growth factor 2 but not VEGF-A(165)-induced NO release PMID: 12543640
  49. This protein is synthesized together with syndecan 1 by mouse mammary gland epithelial cells and bears heparan sulfate chains that are apparently structurally indistinguishable. PMID: 12571251
  50. augmentation of TGF-beta function by induced syndecan-4 was suggested as a mechanism of the suppressive action of syndecan-4 against endotoxin shock PMID: 12975610

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein. Secreted.
Protein Families
Syndecan proteoglycan family
Tissue Specificity
Ubiquitous. Highest levels in liver, kidney and lung.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1