Recombinant Mouse Syntaxin-1A (Stx1a)

Code CSB-CF022895MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Stx1a; Syntaxin-1A; Neuron-specific antigen HPC-1
Species
Mus musculus (Mouse)
Expression Region
1-288
Target Protein Sequence
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an essential role in hormone and neurotransmitter calcium-dependent exocytosis and endocytosis. Part of the SNARE (Soluble NSF Attachment Receptor) complex composed of SNAP25, STX1A and VAMP2 which mediates the fusion of synaptic vesicles with the presynaptic plasma membrane. STX1A and SNAP25 are localized on the plasma membrane while VAMP2 resides in synaptic vesicles. The pairing of the three SNAREs from the N-terminal SNARE motifs to the C-terminal anchors leads to the formation of the SNARE complex, which brings membranes into close proximity and results in final fusion. Participates in the calcium-dependent regulation of acrosomal exocytosis in sperm. Plays also an important role in the exocytosis of hormones such as insulin or glucagon-like peptide 1 (GLP-1).
Gene References into Functions
  1. The role of syntaxin 1A in GLP1 release from intestinal cells as a response to external stimuli is reported. PMID: 28596237
  2. Therefore, our work provides insights into differential functions of Stx1 in neuronal maintenance and neurotransmission, with the latter explored further into its functions in vesicle docking and fusion. PMID: 27466336
  3. Syn-1A actions on newcomer SGs were partly mediated by Syn-1A interactions with newcomer SG VAMP8 PMID: 28031464
  4. The results of this study suggested that STX1A plays an important role in social behavior through regulation of the OXTergic neural system. PMID: 27059771
  5. syntaxin 1 and vesicle-associated membrane protein 1 are more suitable targets to abolish functional soluble N-ethylmaleimide-sensitive factor attachment protein receptor complexes PMID: 24604356
  6. Although STX1A and STX1B share a basic function as neuronal t-SNAREs, STX1B but not STX1A is necessary for the regulation of spontaneous and evoked synaptic vesicle exocytosis in fast transmission. PMID: 24587181
  7. we found that STX1A and STX1B play distinct roles in neuronal survival using PMID: 24666284
  8. point mutation in syntaxin-1A causes abnormal regulation of neuronal plasticity and vesicle recycling and that the affected syntaxin-1A/CaMKII interaction is essential for normal brain and synaptic functions in vivo. PMID: 24136198
  9. overall release efficiency of affected hippocampal neurons was severely impaired by reducing levels of Stx1, as demonstrated by a smaller readily releasable pool size, slower refilling rate of primed vesicles, and lower release probability. PMID: 24133272
  10. CAPS1 binds to the full-length of cytoplasmic syntaxin-1 with preference to its "open" conformation, whereas Munc13-1 binds to the first 80 N-terminal residues of syntaxin-1. PMID: 23801330
  11. The N-terminal syntaxin-1 domains mediate different functions in synaptic vesicle fusion, probably via formation of distinct Munc18/SNARE-protein complexes. PMID: 23188083
  12. Direct interaction between syntaxin 1A and the Kv2.1 C-terminus is required for efficient insulin exocytosis and glucose-stimulated insulin secretion. PMID: 22411134
  13. Nesca directly binds KIF5B, kinesin light-chain and syntaxin-1 PMID: 22404429
  14. Sytaxin 1A may be involved in rearrangement of synaptic connections between neurons in the spinal dorsal horn induced by peripheral nerve injury. PMID: 21129445
  15. Lack of STX1A could induce dysfunction of the HPA axis, and the deficit may result in abnormal behavioural properties, such as unusual responses to stress stimuli. PMID: 21910766
  16. HPC-1/syntaxin 1A regulates catecholaminergic systems via exocytosis of dense-core synaptic vesicles. Deletion of HPC-1/syntaxin 1A causes impairment of long term potentiation induction. PMID: 22219298
  17. Syntaxin-1A inhibits KATP channels by interacting with specific conserved motifs within sulfonylurea receptor 2A. PMID: 21884702
  18. STX1A may play a role in the structural formation of the inner nuclear layer and outer plexiform layer in the retina. PMID: 21822613
  19. granuphilin binds to syntaxin-2 and syntaxin-3 as well as syntaxin-1a, it likely mediates granule docking through interactions with those multiple syntaxins on the plasma membrane. PMID: 21768089
  20. ATP regulates pancreatic beta-cell K(ATP) channel activity, not only by its direct actions on Kir6.2 pore subunit, but also via ATP modulation of Syn-1A binding to SUR1. PMID: 21173146
  21. Data show that ablation of syntaxin 1A may cause disruption of 5-HT-ergic transmission and induce abnormal behavior. PMID: 20576034
  22. syntaxin 1a has a role in granuphilin promotion of plasma membrane targeting of insulin granules PMID: 15028737
  23. These data demonstrate that the Munc18-1 interaction with syntaxin 1 is physiologically important, but does not represent a classical chaperone-substrate relationship. PMID: 15935055
  24. Our data indicate that htt(exon1) enhances calcium influx by blocking syntaxin 1A inhibition of N-type calcium channels and attributes a key role for htt N-terminal fragments in the fine tuning of neurotransmission. PMID: 16162412
  25. These observations suggest that HPC-1/syntaxin 1A may be closely related to synaptic plasticity PMID: 16723534
  26. the interaction of Sept5 with syntaxin-1 is regulated by the phosphorylation of Sept5_v1 at Ser17 by Cdk5-p35 PMID: 17224448
  27. HPC-1/syntaxin 1A might play a role in synaptic plasticity in the nociceptive pathway. PMID: 17953616
  28. Stx1a interaction with the dopamine transporter promotes amphetamine-induced dopamine efflux. PMID: 18617632
  29. syntaxin 1A is an important regulator of normal in utero development, but may not be essential for normal brain function later in life. PMID: 18713622
  30. Homology with vesicle fusion mediator syntaxin-1a predicts determinants of epimorphin/syntaxin-2 function in mammary epithelial morphogenesis.( PMID: 19129200

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Cell membrane.
Protein Families
Syntaxin family
Tissue Specificity
Present in the ileum.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×