Recombinant Mouse Tumor necrosis factor receptor superfamily member 18 (Tnfrsf18)

Code CSB-CF023975MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Tnfrsf18
Uniprot No.
Alternative Names
Tnfrsf18; Gitr; Tumor necrosis factor receptor superfamily member 18; Glucocorticoid-induced TNFR-related protein; CD antigen CD357
Species
Mus musculus (Mouse)
Expression Region
20-228
Target Protein Sequence
QPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway.
Gene References into Functions
  1. These results suggest that therapeutically targeting GITR represents a unique approach to cancer immunotherapy and suggests that a multimeric fusion protein may provide increased agonistic potential versus an antibody PMID: 28069723
  2. These findings support further study into combination partners for GITRL-FP that may augment CD8 T-cell priming as well as provide hypotheses that can be tested in human clinical trials exploring GITR agonists including GITRL-FP. PMID: 28649380
  3. Expression of human GITR was comparable with that of mouse GITR in tumor-infiltrating Tregs despite being drastically lower in other human TILs and in many human peripheral blood populations. PMID: 28611044
  4. anti-GITR mAb shifts Treg populations to enable immune attack on tumors, with clinical implications for molecular markers to modify emerging treatments. PMID: 28122327
  5. Continuous GITR stimulation through B cell Gitrl acts protective in a mouse model of atherosclerosis by regulating the balance between regulatory and effector memory CD4(+) T cells. PMID: 27444204
  6. these results indicate that blockade of GITR signaling can ameliorate arthritis progression mainly by modulating the follicular helper T cell response PMID: 27106763
  7. GITR appears as a potential target for intervention during infection by the parasite Toxoplasma gondii, even though further studies are still necessary to better characterize the immune response triggered by GITR activation during T. gondii infection PMID: 27027302
  8. our data suggest a critical role for GITR in Treg cell homeostasis and indicate that Ptpn22 independently affects the differentiation status of Treg cells and their homeostatic behavior PMID: 26810223
  9. These findings provide further support for the continued development of agonist anti-GITR antibodies as an immunotherapeutic strategy for osteosarcoma. We suggest that our proposed immunotherapy could be developed further to improve osteosarcoma treatment PMID: 26239052
  10. Th9 cells and iTregs are developmentally linked and GITR can subvert tolerogenic conditions to boost Th9 immunity. PMID: 26365427
  11. GITR is a crucial player in differentiation of thymic regulatory T cells and expansion of regulatory T cells, including both thymic regulatory T cells and peripheral regulatory T cells. PMID: 25961057
  12. enhanced GITR-triggering mediates its protective, anti-viral effect on the CD8 T cell compartment by boosting CD4 T cell help. PMID: 25738498
  13. A CD4 T cell-intrinsic role for GITR in sustaining early CD8 and late humoral responses to collectively promote control of chronic LCMV clone 13 infection. PMID: 25590581
  14. GITRL expressed on macrophages drives cytokine release and T cell activation, resulting in neuropathic pain via GITR-dependent actions. The GITRL-GITR pathway might represent a novel target for the treatment of neuropathic pain. PMID: 25787078
  15. Data show that GITR agonist antibody alters Treg lineage stability inducing an inflammatory effector T cell phenotype. The resultant loss of lineage stability causes Treg to lose their intra-tumor immune suppressive function. PMID: 24416730
  16. Inhibition of GITR decreases leukocyte cell adhesion. PMID: 23892569
  17. The effects of GITR activation on Treg cells can have different outcomes depending on the experimental context ranging from expansion in normal mice to death in the Inflammatory bowel disease model. PMID: 23722868
  18. GITR triggering on CD4(+)T cells increases poststroke inflammation and decreases the number of neural stem/progenitor cells induced by ischemia (iNSPCs). PMID: 22052192
  19. these data suggest that GITR plays a role in the survival of CD8 memory phenotype T cells PMID: 22581858
  20. results demonstrate that enhanced GITR/GITRL interactions have a pleiotropic role on the regulation of T-cell responses PMID: 22678896
  21. Treatment with an inhibitor of JNK phosphorylation resulted in complete reversal of all GITR-induced changes in nTreg phenotype and function, with full restoration of suppression of in vivo lung allergic responses PMID: 22461627
  22. Data indicate that GITR does not play a significant role in B cell development and antibody responses to T-dependent and independent model antigens within the context of a GITR-deficient genetic background. PMID: 22328941
  23. GITR is not required on the surface of CD4-positive T-cells to induce colitis in mice. Knockout mice develop aggravated chronic enterocolitis via an imbalance of colitogenic Th1 cells and Treg cells. PMID: 22155173
  24. Data show that GITR plays a role in the modulation of experimental multiple organ dysfunction syndrome. In particular, results show that genetic inhibition of GITR expression reduces inflammation, organ tissue damage, and mortality. PMID: 21654556
  25. A less acute pancreatitis was found in GITR(-/-) mice than in GITR(+/+) mice, with marked differences in edema, neutrophil infiltration, pancreatic dysfunction and injury. PMID: 21091650
  26. GITR plays a role in regulating BMDC activity. PMID: 20883723
  27. In contrast to regulatory CD4+ T cell depletion therapy, GITR stimulation directly on CD8 T cells in melanoma-bearing hosts drives protective and high avidity T cell responses to tumor-specific antigens, inducinrg potent antitumor immunity. PMID: 21106849
  28. CD8 T cell-intrinsic GITR is required for T cell clonal expansion and mouse survival following severe influenza infection. PMID: 21076066
  29. GITR and GITRL are functionally expressed on brain microglia and that the stimulation of GITRL can induce inflammatory activation of microglia. The GITR/GITRL system may play an important role in neuroinflammation. PMID: 20162721
  30. higher levels of expression on regulatory cells than on conventional T cells PMID: 20480365
  31. GITR engagement enhances regulatory T cell proliferation both in vitro and in vivo. PMID: 20139172
  32. Ligation of the costimulatory molecule GITR on Treg inhibits their ability to promote graft survival. PMID: 20148423
  33. Data show that GITR stimulation during established infection markedly improved antiparasitic immunity. PMID: 20139272
  34. the GITR/GITRLigand pathway has a key role in the development of murine autoimmune diabetes PMID: 19936238
  35. systemic administration of LT upregulates the expression of GITR in naive T cells PMID: 20017194
  36. data demonstrate that murine gammadelta-T-cell effector functions and expansion upon activation are very effectively inhibited by alphabeta Treg through a contact-dependent mechanism that can be partially abrogated by manipulating GITR signals. PMID: 19877017
  37. a functional role for this receptor in regulating the CD4+CD25+ T cell subset. PMID: 11869690
  38. Role of GITR in activation response of T lymphocytes. GITR is involved in the regulation of T-cell receptor/CD3-driven T-cell activation and programmed cell death. PMID: 12070049
  39. GITR interacts with the pro-apoptotic protein Siva and induces apoptosis. PMID: 12478477
  40. CD4+GITR+ T cells, regardless of CD25 antigen expression, regulate mucosal immune responses and control intestinal inflammation. PMID: 12847237
  41. Identification of GITRL as a ligand for glucocorticoid-induced tumor necrosis factor receptor in dendritic cells. PMID: 14521928
  42. GITR may play a role in body's inflammatory processes PMID: 14646588
  43. GITR has a costimulatory function in T cell subsets. PMID: 14991590
  44. GITR costimulation showed a potent ability to produce high amounts of IL-10, which resulted in counter-regulation of enhanced CD4+ T cells proliferative responses. GITR acts as a potent and unique costimulator for an early CD4+ T cell activation. PMID: 15187106
  45. GITR activation induces an opposite effect on alloreactive CD4(+) and CD8(+) T cells in graft-versus-host disease PMID: 15249593
  46. GITR plays an important role in the ischemia and reperfusion injury and put forward the hypothesis that modulation of GITR expression may represent a novel and possible strategy. PMID: 15316036
  47. GITR engagement on CD25-, not CD25+ T cells abrogates T cell-mediated suppression. PMID: 15470044
  48. sGITR enhances osteoclastogenesis by acting on OC precursor cells to lower the level of IFN-beta PMID: 15814301
  49. GITR promotes the activation, survival, and cytokine production of T cells; furthermore, GITR can induce the activation of NF-kappa B and all three subfamilies of MAP kinases (ERKs, JNKs, and p38). PMID: 15944292
  50. GITR protects keratinocytes from UVB-induced apoptosis both in vitro and in vivo under negative transcriptional control of p21Cip1. PMID: 16155000

Show More

Hide All

Subcellular Location
[Isoform A]: Cell membrane; Single-pass type I membrane protein.; [Isoform B]: Cell membrane; Single-pass type I membrane protein.; [Isoform C]: Cell membrane; Single-pass type I membrane protein.; [Isoform D]: Secreted.
Tissue Specificity
Preferentially expressed in activated T lymphocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1