Recombinant Mouse Zinc transporter 1 (Slc30a1)

Code CSB-CF733704MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Slc30a1
Uniprot No.
Alternative Names
Slc30a1; Znt1; Zinc transporter 1; ZnT-1; Solute carrier family 30 member 1
Species
Mus musculus (Mouse)
Expression Region
1-503
Target Protein Sequence
MGCWGRNRGRLLCMLLLTFMFMVLEVVVSRVTASLAMLSDSFHMLSDVLALVVALVAERF ARRTHATQKNTFGWIRAEVMGALVNAIFLTGLCFAILLEAVERFIEPHEMQQPLVVLSVG VAGLLVNVLGLCLFHHHSGEGQGAGHGHSHGHGHGHLAKGARKAGRAGVEAGAPPGRAPD QEETNTLVANTSNSNGLKADQAEPEKLRSDDPVDVQVNGNLIQESDNLEAEDNRAGQLNM RGVFLHVLGDALGSVIVVVNALVFYFNWKGCTEDDFCTNPCFPDPCKSSVEIINSTQAPM RDAGPCWVLYLDPTLCIIMVCILLYTTYPLLKESALILLQTVPKQIDIKHLVKELRDVDG VEEVHELHVWQLAGSRIIATAHIKCEDPASYMQVAKTIKDVFHNHGIHATTIQPEFASVG SKSSVLPCELACRTQCALKQCCGTRPQVHSGKDAEKAPTVSISCLELSENLEKKARRTKA EGSLPAVVIEIKNVPNKQPESSL
Protein Length
full length protein
Tag Info
The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in zinc transport out of the cell. Lethality of knockout early in gestation suggests a role of the protein in fetal zinc acquisition and retention.
Gene References into Functions
  1. This study has identified ZnT1 as a novel postsynaptic density protein. PMID: 24602382
  2. C-terminal domain of ZnT-1 was responsible for its protective effect against ischemia-reperfusion , while this part of the ZnT-1 protein did not have a protective effect against the toxicity of zinc PMID: 22193398
  3. Data suggest that expression of zinc homeostatic proteins such as ZnT1 and 3, and metallothioneins 1 and 2, is regulated by crosstalk between synaptic and intracellular pools of Zn(2+). PMID: 20432464
  4. Expression of zinc transporter ZnT1 in mouse choroid epithelial cells suggests that the choroid plexus plays an important role in regulation of zinc homeostasis in the brain. PMID: 15257151
  5. Znt1 provides an essential function during early embryonic development. PMID: 15452870
  6. Cadmium exposure down-regulated ZnT-1 gene expression in the conceptus of mice. PMID: 17669619
  7. The expression of Slc30a1, Slc39a8, and Slc39a10 in the erythrocytes of zinc deficient and replete mice is reported. PMID: 18936201

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Tissue Specificity
Widely expressed.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1