Recombinant Mouse Zinc transporter 7 (Slc30a7)

Code CSB-CF872871MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Slc30a7
Uniprot No.
Alternative Names
Slc30a7; Znt7; Zntl2; Zinc transporter 7; ZnT-7; Solute carrier family 30 member 7; Znt-like transporter 2
Species
Mus musculus (Mouse)
Expression Region
1-378
Target Protein Sequence
MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFN GALDHSHGHEDHCHSHEAKHGAAHSHDHDHAHGHGHLHSHDGPSFKATAGPSRQILQGVF LHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTP PSLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNI FTQAGVRQLYVQIDFAAM
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Seems to facilitate zinc transport from the cytoplasm into the Golgi apparatus. Partly regulates cellular zinc homeostasis. Required with ZNT5 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and the vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT5 and ZNT6 for the activation of TNAP.
Gene References into Functions
  1. A role for ZnT7 in adipocyte lipogenesis: reduction of Znt7 expression affects lipid accumulation in adipocytes. PMID: 26524605
  2. In Znt7 knockout mice, the body weight and fat deposit was significantly linked to a locus on chromosome 7 ranging from 64.3 to 78.3 Mb. PMID: 24770585
  3. ZnT7 promotes cell survival via two distinct signaling pathways involving activation of the PI3K/Akt-mediated survival pathway and activation of MAPK/ERK pathway. PMID: 23403124
  4. Znt7-null mice are more susceptible to diet-induced glucose intolerance and insulin resistance PMID: 22854958
  5. A null-mutation of the Znt7 gene accelerates prostate tumor formation in TRAMP mice. PMID: 21621325
  6. novel member of zinc transporter family that accumulates zinc in the Golgi apparatus PMID: 12446736
  7. ZnT5(-)ZnT7(-/-) cells showed exacerbation of the unfolded protein response as did the wild-type cells cultured under a zinc-deficient condition, revealing that both complexes play a role in homeostatic maintenance of secretory pathway function PMID: 16636052
  8. These observations strongly suggest that ZnT7 may play critical roles in retinal zinc homeostasis and that chelatable zinc pools may have multiple functions in the retina. PMID: 17113933
  9. ZNT7 has essential functions in dietary zinc absorption and in regulation of body adiposity. PMID: 17954933
  10. These observations support the notion that ZnT7 may participate in zinc transport, storage, and incorporation of zinc into zinc-binding proteins in the Golgi apparatus of mouse SCG neurons. PMID: 18499530
  11. ZNT7 and chelatable zinc were distributed in different cell populations. ZNT7 may be involved in zinc transportation into the Golgi apparatus for protein packaging in the mouse testis PMID: 19012241
  12. Immunoelectron microscopic study showed that ZNT7 was localized to the membrane of the Golgi apparatus in the somas of the Purkinje cells, Bergmann glial cells, and granule cells throughout the cerebellar cortex. PMID: 19283665

Show More

Hide All

Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Tissue Specificity
Highly expressed in liver, spleen, duodenum and part of the jejunum of small intestine (at protein level). Moderately expressed in kidney, lung, and brain. Barely detectable in heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X