Recombinant Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 1, chloroplastic(PPT1)

Code CSB-CF718186OFG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q69VR7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Oryza sativa subsp. japonica (Rice)
Sequence ASPEQEDERRRGARDVAVAATAAAAGEAGAEEGGGLAKTLQLGALFGLWYLFNIYFNIYN KQVLKVFPYPINITNVQFAVGTVIALFMWITGILKRPKISGAQLAAILPLAMVHTMGNLF TNMSLGKVAVSFTHTIKAMEPFFSVLLSALFLGEMPTPFVVLSLVPIVGGVALASLTEAS FNWAGFWSAMASNVTFQSRNVLSKKLMVKKEESLDNITLFSIITVMSFFLLAPVTLLTEG VKVTPTVLQSAGLNLKQIYTRSLIAAFCFHAYQQVSYMILARVSPVTHSVGNCVKRVVVI VTSVLFFRTPVSPINSLGTGVALAGVFLYSQLKRLKPKPKTA
Source in vitro E.coli expression system
Gene Names PPT1
Protein Names Recommended name: Phosphoenolpyruvate/phosphate translocator 1, chloroplastic Short name= OsPPT1
Expression Region 67-408
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Phosphoenolpyruvate/phosphate translocator that transports phosphoenolpyruvate (PEP) and dihydroxyacetone phosphate.
Subcellular Location Plastid, chloroplast membrane, Multi-pass membrane protein
Protein Families TPT transporter family, PPT (TC 2.A.7.9) subfamily
Database Links

KEGG: osa:4346653

STRING: 39947.LOC_Os09g12600.1

UniGene: Os.4694

Related Products

PPT1 Antibodies

PPT1 Antibodies for Oryza sativa subsp. japonica (Rice)

PPT1 Proteins

PPT1 Proteins for Oryza sativa subsp. japonica (Rice)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.