Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (Srd5a2)

Code CSB-CF022654RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Srd5a2
Uniprot No.
Alternative Names
Srd5a2; 3-oxo-5-alpha-steroid 4-dehydrogenase 2; 5 alpha-SR2; SR type 2; Steroid 5-alpha-reductase 2; S5AR 2
Species
Rattus norvegicus (Rat)
Expression Region
1-254
Target Protein Sequence
MQIVCHQVPVLAGSATLATMGTLILCLGKPASYGKHTESVSSGVPFLPARIAWFLQELPS FVVSVGMLAWQPRSLFGPPGNVLLALFSAHYFHRTFIYSLLTRGRPFPAVLFLRATAFCI GNGLLQAYYLVYCAEYPEEWYTDVRFSFGVFLFILGMGINIHSDYTLRQLRKPGEVIYRI PRGGLFTYVSGANFLGEIIEWIGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFK DYPKSRKALIPFIF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Gene References into Functions
  1. Results suggest that in the acute phase after spinal cord injury, the increased expression of 18kDa translocator protein and 5alpha-reductase may represent a protective endogenous response against tissue injury. PMID: 27150077
  2. findings show that, in the adult brain, 5alphaR2 is distributed in critical regions for behavioral regulation, suggesting that the functional role of this isoform is present throughout the entire lifespan of the individual PMID: 22776423
  3. Low Srd5a2 expression is associated with benign prostatic hypertrophy. PMID: 23405234
  4. Changes in the expression of steroid 5-alpha reductase isoenzymes in the prostate in response to environmental stress. PMID: 23122426
  5. Tesosterone concentrations during postnatal sexual differentiation of the rat central nervous system, among other sex-dependent factors, influence brain levels of 5alpha-Reductase isozymes in adulthood PMID: 22131296
  6. 5-alpha-reductase type 2 is confined to motoneuronal cells of anterior horns of rat spinal cord, cells that also are known to express high levels of androgen receptor. PMID: 12899683
  7. A method for the quantitation of mRNA levels of Srd5a2 isoenzymes has been developed. PMID: 14592534
  8. 5 alpha-R2 labeling was observed in dorsal (DH) and ventral horns of gray matter (Gm). and 60% of 5 alpha-R2 immunostaining colocalized with oligodendrocyte, 25% with neuron, and 15% with astrocyte markers. PMID: 15305365
  9. regulatory elements and the minimal promoter were mapped to the 485-bp region upstream of the start codon PMID: 15576829
  10. A high-dietary fat and caloric intake upregulates prostate 5alpha-reductase-2 gene expression, and stimulates prostate growth in neonatal, but not adult r PMID: 16425201
  11. great sexual dimorphism in the central nervous system (CNS) with respect to both 5alpha-reductase isozymes, and suggest a crucial role of dihydrotestosterone in the sexual dimorphism of the CNS in the female PMID: 16595696
  12. The SRD5A2 mRNA expression in normal rat is 4-fold higher than human prostatic tissue. PMID: 16818707

Show More

Hide All

Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Steroid 5-alpha reductase family
Tissue Specificity
Expressed in high levels in the prostate and many other androgen-sensitive tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X