Recombinant Rat Amphiregulin(Areg)

Code CSB-CF001986RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Areg
Uniprot No. P24338
Alternative Names Areg; SdgfAmphiregulin; AR; Schwannoma-derived growth factor; SDGF
Species Rattus norvegicus (Rat)
Expression Region 97-243
Target Protein Sequence VIKPKENKTEGEKSSEKPKRKKKGGKGGKGRRNRKKKKNPCAAKFQNFCIHGECRYIENLEVVTCHCHQDYFGERCGEKTMKTQKKDDSDLSKIALAAIIVFVSAVSVAAIGIITAVLLRKRFFREYEEAEERRRLRQENGTAHAIA
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.
Gene References into Functions
  1. Report increased AREG transcript and protein levels in the lungs of rodents with DA-induced bronchiolitis obliterans. PMID: 24816162
  2. estrogen and progeterone increased cell proliferation in normal gland and mammary cancers through the increased production of amphiregulin PMID: 21258428
  3. may play a role in the ovulatory process of cycling rats as well as in the induction of ovulation in immature rats PMID: 15291759
  4. the expression of amphiregulin (AR), a member of the epidermal growth factor (EGF) family, is rapidly and highly up-regulated by PTH in several osteoblastic cell lines and bone tissues PMID: 15509566
  5. findings identify Amphiregulin as a factor for resistance of glioma cells to delta9-Tetrahydrocannabinol induced apoptosis PMID: 19229996

Show More

Hide All

Subcellular Location Membrane, Single-pass membrane protein
Protein Families Amphiregulin family
Database Links

KEGG: rno:29183

STRING: 10116.ENSRNOP00000003703

UniGene: Rn.10568

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1