Recombinant Rat Amphiregulin(Areg)

Code CSB-CF001986RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P24338
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence VIKPKENKTEGEKSSEKPKRKKKGGKGGKGRRNRKKKKNPCAAKFQNFCIHGECRYIENLEVVTCHCHQDYFGERCGEKTMKTQKKDDSDLSKIALAAIIVFVSAVSVAAIGIITAVLLRKRFFREYEEAEERRRLRQENGTAHAIA
Source in vitro E.coli expression system
Gene Names Areg
Protein Names Recommended name: Amphiregulin Short name= ARAlternative name(s): Schwannoma-derived growth factor Short name= SDGF
Expression Region 97-243
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.
Subcellular Location Membrane, Single-pass membrane protein
Protein Families Amphiregulin family
Database Links

KEGG: rno:29183

STRING: 10116.ENSRNOP00000003703

UniGene: Rn.10568

Pathway ErbB signaling pathway
Hippo signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway

Related Products

Areg Proteins

Areg Proteins for Rattus norvegicus (Rat)

Areg ELISA Kit

Areg ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.