Recombinant Rat Bile acyl-CoA synthetase (Slc27a5)

Code CSB-CF872138RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Slc27a5; Acsb; Fatp5; Vlacsr; Bile acyl-CoA synthetase; BACS; Bile acid-CoA ligase; BA-CoA ligase; BAL; Cholate--CoA ligase; Fatty acid transport protein 5; FATP-5; Solute carrier family 27 member 5; Very long-chain acyl-CoA synthetase-related protein; VLACS-related; VLACSR
Species
Rattus norvegicus (Rat)
Expression Region
1-690
Target Protein Sequence
MGVWKKLTFLLLSLLLLVGLGQPLWPAATALALRWFLGDPTCFVLLGLAFLGRPWISSWI PHWLSLAAAALTLSLLPPRPPPELRWLHKDVAFAFKLLFYGLNLRRRLNRHPPELFVDAL EQQAQARPDQVALVCTGSEGCSITNRELNAKACQAAWALKAKLKEATIQEDKGATAILVL PSKSISALSVFLGLAKLGCPVAWINPHSRGMPLLHSVQSSGASVLIVDPDLQENLEEVLP KLLAENIRCFYLGHSSPTPGVEALGAALDAAPSDPVPAKLRANIKWKSPAIFIYTSGTTG LPKPAILSHERVIQMSNVLSFCGRTADDVVYNVLPLYHSMGLVLGVLGCLQLGATCVLAP KFSASRYWAECRQYSVTVVLYVGEVLRYLCNVPGQPEDKKHTVRFALGNGLRADVWENFQ QRFGPIQIWELYGSTEGNVGLMNYVGHCGAVGKTSCFIRMLTPLELVQFDIETAEPVRDK QGFCIPVETGKPGLLLTKIRKNQPFLGYRGSQDETKRKLVANVRQVGDLYYNTGDVLALD QEGFFYFRDRLGDTFRWKGENVSTREVEGVLSILDFLEEVNVYGVTVPGCEGKVGMAAVK LAPGKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNTYKLVKSQLAREGFDVGVIAD PLYILDNKAETFRSLMPDVYQAVCEGTWKL
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acyl-CoA synthetase that catalyzes the activation of bile acids via formation of bile acid CoA thioesters which is necessary for their subsequent conjugation with glycine or taurine. Catalyzes the activation of the primary bile acid, chenodeoxycholic acid. Both primary bile acid (cholic acid) and secondary bile acids (deoxycholic acid and lithocholic acid) are the principal substrates. Also exhibits acyl CoA synthetase activity that activates very long-chain fatty acids (VLCFAs) by catalyzing the formation of fatty acyl-CoA. In vitro, also activates 3-alpha,7-alpha,12-alpha-trihydroxy-5- beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Exhibits long-chain fatty acids (LCFA) transport activity. Plays an important role in hepatic fatty acid uptake and bile acid reconjugation and recycling but not in de novo synthesis of bile acids.
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome. Cell membrane; Multi-pass membrane protein.
Protein Families
ATP-dependent AMP-binding enzyme family
Tissue Specificity
Predominantly expressed in liver (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1