Recombinant Rat Cannabinoid receptor 1 (CNR1)-VLPs

Code CSB-MP005678RA
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
(CB-R)(CB1)(Brain-type cannabinoid receptor)
Species
Rattus norvegicus (Rat)
Source
Mammalian cell
Expression Region
1-473aa
Target Protein Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for cannabinoids, including endocannabinoids (eCBs), such as N-arachidonoylethanolamide (also called anandamide or AEA) and 2-arachidonoylglycerol (2-AG). Mediates many cannabinoid-induced effects, acting, among others, on food intake, memory loss, gastrointestinal motility, catalepsy, ambulatory activity, anxiety, chronic pain. Signaling typically involves reduction in cyclic AMP. In the hypothalamus, may have a dual effect on mitochondrial respiration depending upon the agonist dose and possibly upon the cell type. Increases respiration at low doses, while decreases respiration at high doses. At high doses, CNR1 signal transduction involves G-protein alpha-i protein activation and subsequent inhibition of mitochondrial soluble adenylate cyclase, decrease in cyclic AMP concentration, inhibition of protein kinase A (PKA)-dependent phosphorylation of specific subunits of the mitochondrial electron transport system, including NDUFS2. In the hypothalamus, inhibits leptin-induced reactive oxygen species (ROS) formation and mediates cannabinoid-induced increase in SREBF1 and FASN gene expression. In response to cannabinoids, drives the release of orexigenic beta-endorphin, but not that of melanocyte-stimulating hormone alpha/alpha-MSH, from hypothalamic POMC neurons, hence promoting food intake. In the hippocampus, regulates cellular respiration and energy production in response to cannabinoids. Involved in cannabinoid-dependent depolarization-induced suppression of inhibition (DSI), a process in which depolarization of CA1 postsynaptic pyramidal neurons mobilizes eCBs, which retrogradely activate presynaptic CB1 receptors, transiently decreasing GABAergic inhibitory neurotransmission. Also reduces excitatory synaptic transmission. In superior cervical ganglions and cerebral vascular smooth muscle cells, inhibits voltage-gated Ca(2+) channels in a constitutive, as well as agonist-dependent manner. Induces leptin production in adipocytes and reduces LRP2-mediated leptin clearance in the kidney, hence participating in hyperleptinemia. In adipose tissue, CNR1 signaling leads to increased expression of SREBF1, ACACA and FASN genes. In the liver, activation by endocannabinoids leads to increased de novo lipogenesis and reduced fatty acid catabolism, associated with increased expression of SREBF1/SREBP-1, GCK, ACACA, ACACB and FASN genes. May also affect de novo cholesterol synthesis and HDL-cholesteryl ether uptake. Peripherally modulates energy metabolism. In high carbohydrate diet-induced obesity, may decrease the expression of mitochondrial dihydrolipoyl dehydrogenase/DLD in striated muscles, as well as that of selected glucose/ pyruvate metabolic enzymes, hence affecting energy expenditure through mitochondrial metabolism. In response to cannabinoid anandamide, elicits a proinflammatory response in macrophages, which involves NLRP3 inflammasome activation and IL1B and IL18 secretion. In macrophages infiltrating pancreatic islets, this process may participate in the progression of type-2 diabetes and associated loss of pancreatic beta-cells.
Gene References into Functions
  1. he administration of FAAH inhibitor resulted in increased level of endocannabinoids in kidney of both groups of hypertensive rats led to enhanced expression of the cannabinoid receptors type 1 and 2 in SHR as well as vanilloid receptor 1 receptors in DOCA-salt rats. PMID: 29197803
  2. Results showed sensitivity of activated microglial cells to cannabinoids, increased CB1-CB2Het expression in activated microglia and in microglia from the hippocampus of an Alzheimer's model, and a correlation between levodopa-induced dyskinesia and striatal microglial activation in a Parkinson's disease model. PMID: 28843453
  3. A possible reduction in CB1R functionality, coupled with a hyperfunctional AT1R in the brainstem, could well be significant factors in the development of hypertensive states. AT1R-mediated phosphorylation of CB1R could be critical for impaired cerebellar development characterized by a hyperactive RAS PMID: 28887229
  4. observed selective alterations of DNA methylation at the promoter of CNR1, the gene coding for the type-1 cannabinoid receptor, in schizophrenic patients with no changes in bipolar or major depressive disorder. In an animal model prefrontal cortex found a significant increase in CNR1 expression and a consistent reduction in DNA methylation at specific CpG sites of gene promoter. PMID: 28108228
  5. Adolescent rats show an indiscriminate food seeking behavior, and a high motivation for food defining adolescent rats as impulsive. These traits are absent in adults and aged rats. CB1R and CB2R have an age-related expression, suggesting CB1R and CB2R may be considered part of the mechanisms that underlie motivated behavior. PMID: 27935269
  6. These findings identify a unique mechanism whereby bi-directional basolateral amygdala CB1R transmission can regulate opiate-related motivational processing and control affective states through functional modulation of mesolimbic neuronal activity. PMID: 27230434
  7. The results demonstrate that the neural coordination between the the gustatory and gastrointestinal insula is generated or suppressed by the opposing activities between CB1R and GPR119. PMID: 27581068
  8. results imply that endogenous cannabinoids may modulate the excitability and the output of Retinal Ganglion Cellss by differentially suppressing the activity of L- and T-type Calcium channels through activation of CB1Rs and CB2Rs. PMID: 28431968
  9. Data suggest maternal high-fat (HF) diet alters endocannabinoid system components and energy metabolism in hypothalamus and brown adipose tissue (BAT) of offspring at birth, in sex-specific manner; maternal HF diet up-regulates hypothalamic Cnr1 expression in male pups; maternal HF diet up-regulates hypothalamic Cnr2 expression in female pups; maternal HF diet down-regulates Cnr1 and up-regulates Cnr2 in BAT of all pups. PMID: 29102876
  10. Results suggest that, in male rats, endocannabinoids mediate immune challenge-inhibitory effects on reproductive axis at least partially via hypothalamic CB1 receptor activation. PMID: 28665507
  11. we have shown diurnal changes of cannabinoid receptor type 1 and type 2, which are of significant physiological and clinical interest. Considering the diurnal rhythm, the variation of CBR expression seems to be predominantly driven by food entrainment. Diurnal receptor changes are influenced by age. PMID: 28837063
  12. Study shows that the CB1R levels in dorsal hippocampus are increased by acquisition and reinstatement of morphine conditioned place preference. Intrahippocampal infusion of CB1R inverse agonists prevent morphine conditioned place preference reinstatement but not acquisition, suggesting that CB1R inverse agonist might be useful in the prevention of relapse to opiates. PMID: 28492416
  13. The presumably adverse experience of interacting with an unresponsive play partner appears to involve CB1R dependent mechanisms, since changes in play-soliciting behavior as well as the subsequent decrease in thermal pain sensitivity could be restored by acute administration of the CB1R antagonist/inverse agonist SR141716. PMID: 27157075
  14. The CB1 neutral antagonist AM4113 significantly attenuated nicotine taking, motivation for nicotine, as well as cue-, priming- and stress-induced reinstatement of nicotine-seeking behavior. PMID: 27493155
  15. Study analyzed the changes in the endogenous cannabinoid system (ECS) 12 months after experimental traumatic brain injury for the first time. The results showed that the expression of the CB1 receptor and 2-AG in the post-traumatic epilepsy (PTE) group was significantly higher than that in the non-PTE group, indicating that the ECS is involved in PTE pathology. PMID: 27810514
  16. Results showed that CB1R and SSTR5 colocalized in rat brain cortex, striatum, and hippocampus. CB1R was expressed in SSTR5 immunoprecipitate prepared from the brain tissue lysate, indicating their association in a system where these receptors are endogenously expressed. PMID: 27984180
  17. Results indicate that the early phases of excitotoxic spinal cord injury could not be arrested by pharmacologically exploiting the endocannabinoid system, consistent with the notion that CB1 agonist anandamide and its derivatives are more useful to treat late spinal cord injury phases. PMID: 27450568
  18. Data show a pivotal role for CB1 cannabinoid receptors, specifically those located in GABAergic cells, in the memory impairment and structural dendritic morphology alterations associated with the nicotine withdrawal syndrome. PMID: 27737762
  19. U46619 and ANG II may stimulate rapid endothelial release of endocannabinoids (mainly 2-arachidonoylglycerol), leading to CB1 receptor-dependent and/or CB1 receptor-independent vasorelaxation, which in the negative feedback mechanism reduces later agonist-induced vasoconstriction. PMID: 28356298
  20. demonstrate for the first time that Hippocampal CB1R transmission can potently modulate n. accumbens neuronal activity and can differentially control the formation of context-dependent and context-independent forms of rewarding or aversion-related emotional associative memories. PMID: 26681496
  21. Study concludes that exposure to post-training inescapable stress impaired memory consolidation. The impairing effects of stress on memory retrieval may be mediated by the ventral hippocampus cannabinoid CB1 receptors. PMID: 27282634
  22. Neuronal and smooth muscle CB1 and CB2 receptor expression and the nerve fiber density was diminished in the Obese Zucker Rat bladder. PMID: 27285468
  23. CB1 activation enhances protein synthesis via the mTOR pathway, resulting in long-term depression of inhibitory transmission in GABA-ergic presynaptic interneuron axons. PMID: 27764673
  24. Anandamide modulates the pro-aversive effects of intra-dorsomedial division of the ventromedial hypothalamus-bicuculline treatment, recruiting CB1 cannabinoid receptors and the TRPV1 channel is involved in the AM251-related potentiation of bicuculline effects on non-oriented escape behaviour. PMID: 27062913
  25. ZDF rats with global deletion of CB1R are protected from beta-cell loss, hyperglycemia, and nephropathy that are present in ZDF littermates. Adoptive transfer of CB1R(-/-) bone marrow to ZDF rats also prevents beta-cell loss and hyperglycemia but not nephropathy. PMID: 28082458
  26. Data suggest synthesis of endocannabinoids and expression of endocannabinoid receptors (Cnr1, Cnr2, and Trpv1) are altered in tissue-specific manner in obesity due to high-fat diet; chronic exercise reverses some of these alterations in skeletal muscle and subcutaneous/visceral adipose tissues. PMID: 26880264
  27. The bi-directional CB1 receptor-mediated cardiovascular effects of cannabinoids microinjected into the PVN of anaesthetized rats depend on stimulatory glutamatergic and inhibitory GABAergic inputs to the sympathetic tone. PMID: 27659492
  28. study showed the protective role of cannabinoid CB1 receptors in DOCA-salt small Mesenteric Arteries. PMID: 26969765
  29. Results support the possibility that dorsolateral periaqueductal gray cannabinoid type 1 and transient potential vanilloid type 1 receptors are involved in the expression of conditioned emotional response through the NMDA/NO/sGC pathway PMID: 26724373
  30. The results of this study suggest that decreased CB1 receptor expression is likely associated with the development of post-stroke depression. PMID: 26778127
  31. Data suggest that alterations of hippocampal cannabinoid type-1 receptors expression and function in food restricted rats are associated with dendritic spine remodeling and functional potentiation of CA1 excitatory synapses, and these findings are consistent with increasing evidence supporting the idea that food restriction may improve cognitive functions. PMID: 26354043
  32. Inhibition of the regulator of G protein signalling RGS4 in the spinal cord decreases neuropathic hyperalgesia and restores cannabinoid CB1 receptor signalling PMID: 26478461
  33. CB1 receptor mediated retrograde regulation provides a novel mechanism for modulating excitatory synaptic transmission in the inner retina. PMID: 25273281
  34. Curcumin and hemopressin treatment attenuates cholestasis-induced liver fibrosis in rats: role of CB1 receptors PMID: 26475620
  35. Data suggest a strong interaction between 5-HT4 and CB1 receptors within the nucleus accumbens shell PMID: 26340366
  36. Results imply that activation of TRH receptors in these midline thalamic neurons engages novel signaling pathways that include postsynaptic intracellular CB1 and CB2 receptors in the activation of TRPC4/5-like channels PMID: 26470810
  37. CB1Rs modulate the hydroelectrolytic balance independently of the food intake during sustained hyperosmolality and hypovolemia. PMID: 26497248
  38. Results suggest that Cnr1 and the cannabinoid system of the retrosplenial cortex modulate emotional memory PMID: 26572648
  39. Co-injection of Cnr1/2 antagonists with morphine attenuated expression of tolerance to morphine analgesic effects and decreased the morphine analgesia. PMID: 25894754
  40. The main findings of the experiments are, first, that antagonism of CB1 receptors increased anxiety-like and fear behavior in female rats. Second, a modest anxiolytic effect of CB1 receptor agonism was observed in the open field test. PMID: 26311003
  41. Study suggested that somatostatin and nNOS are expressed in most interneurons whereas CB1 receptor is present in both interneurons and projection neurons in hippocampal regions PMID: 26115586
  42. Results suggest that orexin-A/OX1R dependent activation of the RVLM nNOS/ERK1/2 cascade is essential neurochemical mechanism for the central CB1R-mediated pressor response in conscious rats PMID: 26096126
  43. Genetic and pharmacological study indicates that CB1R are not necessary for adaptation of the HPA axis and other variables to repeated exposure to stress either in mice or rats PMID: 26092203
  44. CB1Rs participate in the homeostatic responses regulating fluid balance and energy homeostasis during water deprivation. PMID: 26468265
  45. interactive role of cannabinoid and vanilloid systems in hippocampal synaptic plasticity PMID: 25843413
  46. This animal model show that the activity state of the CB1R is an important molecular mediator of adolescent behavior. PMID: 26468198
  47. Study showed an overlapping distribution of CB1 and OX1 in status epilepticus hippocampus; increased hippocampal expression of CB1 indicates that CB1 may play an important role in the underlying disease mechanism, but the effect of OX1 was not obvious PMID: 25446454
  48. During liver regeneration signaling mediated by anandamide through CB1 receptor may be important for the entry and progression of cells into the cell cycle and hence for their proliferation under mitogenic signals. PMID: 25684344
  49. Vasoconstriction and hypertension is modulated by endocannabinoid-induced Galphaq11-CB1 cannabinoid receptor signaling. PMID: 25595485
  50. The studies reveal how CB1 receptor activation translates into beta-arrestin signaling and identify a mechanism to control this pathway. PMID: 25081814

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Mitochondrion outer membrane. Cell projection, axon. Cell junction, synapse, presynapse.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the brain, in the striatum, medial septum, descending arm of the band of Broca, the amygdaloid nucleus, the hippocampus and cortex (at protein level). High levels in the lateral striatum. In rostral brain regions, high expression levels in th
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*