Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Cldn5

Uniprot No.

Q9JKD6

Research Area

Neuroscience

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-218aa

Target Protein Sequence

MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.6 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The Recombinant Rat Claudin-5 (Cldn5) protein is a high-quality, full-length recombinant protein specifically designed for neuroscience research. Its key advantage lies in its verified identity and purity, which are critically important for studies focusing on the blood-brain barrier, where Cldn5 is a key component. This recombinant Cldn5 protein, corresponding to amino acids 1-218 of rat Cldn5, is expressed with an N-terminal 10xHis tag in an in vitro E. coli system. The product's reliability is demonstrated by rigorous quality control: purity is confirmed to be greater than 85% by SDS-PAGE analysis, and its identity is further validated by Western Blot, which shows a specific band at the expected molecular weight (approximately 22-26 kDa). This dual demonstrates its integrity and confirms its suitability as an ideal immunogen for antibody production, as a positive control in immunoassays in neurovascular research.

Target Background

Function

Plays a major role in tight junction-specific obliteration of the intercellular space.

Gene References into Functions

claudin-5 might represent a novel pharmacological target for treating acute lung injury induced by H2S and other hazardous gases. PMID: 28741371
in response to alcohol, increased claudin-5 paradoxically accompanies an increase in paracellular leak and rearrangement of alveolar tight junctions. PMID: 27452368
Immunocytochemistry and Western blotting showed that claudin-5, a critical regulatory protein for tight junctions, was translocated from the membrane to the cytoplasm after cooling in cultured bEnd3 cells PMID: 23653089
Increased claudin-5 and claudin-1 expression and decreased permeability of the blood brain barrier were observed in the hyperbaric oxygenation and cerebral ischemia-reperfusion injury group. PMID: 21626096
Claudin-5 redistribution, mediated by caveolin-1, was observed in blood brain barrier following ischemic stroke. PMID: 22378877
Levels of tight junction protein claudin 5 are decreased in blood-brain barrier cells post-translationally following neurotoxicant administration. PMID: 20970449
Blood-brain barrier permeability increases after stroke through matrix metalloprotein-mediated degradation of claudin-5 and occuludin in tight junctions. PMID: 21717368
Data demonstrate the timing of tight junction-associated proteins claudin-5, occludin, and ZO-1 in light of blood-brain barrier permeability associated with cerebral ischemia reperfusion. PMID: 21318404
These findings suggest that claudin-5 is a main claudin expressed in podocytes and that the formation of tight junctions in the nephrosis may be due to local recruitment of claudin-5 rather than due to total upregulation of the claudin protein levels. PMID: 21271259
claudin-5 and occludin translocate reversibly within cells of the rat blood-optic nerve barrier after borneol treatment PMID: 20473716
Increased buffer concentration by addition of HEPES, MOPS, or TES to the media during differentiation increased independent of the type of buffer. This correlated with increased expression of claudin-5 PMID: 20967520
MUPP1 and claudin-5 colocalized in the incisures, and the COOH-terminal region of claudin-5 interacts with MUPP1 in a PSD-95/Disc Large/zona occludens (ZO)-1 (PDZ)-dependent manner in tight junctions PMID: 12403818
Induction of wild-type claudin-5 is sufficient to reconstitute the paracellular barrier against inulin (5 kDa), but not mannitol (182 Da), in leaky rat lung epithelial cells PMID: 15383327
Data show that adrenomedullin inhibits paracellular transport in a blood-brain barrier in vitro model through claudin-5 overexpression. PMID: 16763778
Claudin 5 is predominantly expressed in brain capillaries, and plays a key role in the appearance of barrier properties of brain capillary endothelial cells. PMID: 16998798
Immunogold electron microscopy demonstrated claudin-5 localized in the tight-junctional fused membranes of adjacent endothelial cells. PMID: 17899156

Hide All

Subcellular Location

Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Protein Families

Claudin family

Database Links

KEGG: rno:65131

STRING: 10116.ENSRNOP00000064048

UniGene: Rn.17420

Code	CSB-CF867513RA
Abbreviation	Recombinant Rat Cldn5 protein
MSDS	MSDS Datasheet
Size	$1620
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Claudin-5 (Cldn5)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage