Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r)

Code CSB-CF009514RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P32301
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERNSPEEQLLSLYIIYTVGYALSFSALVIASAILVSFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLVFIRVICIVIAKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFVKLFTELSFTSFQGFMVAVLYCFVNNEVQMEFRKSWERWRLERLNIQRDSSMKPLKCPTSSVSSGATVGSSVYAATCQNSCS
Source in vitro E.coli expression system
Gene Names Glp1r
Protein Names Recommended name: Glucagon-like peptide 1 receptor Short name= GLP-1 receptor Short name= GLP-1-R Short name= GLP-1R
Expression Region 22-463
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Tissue Specificity Pancreatic islets, stomach, lung, rat insulinoma cell line.
Database Links

KEGG: rno:25051

STRING: 10116.ENSRNOP00000001527

UniGene: Rn.11408

Pathway cAMP signaling pathway

Related Products

Glp1r Antibodies

Glp1r Antibodies for Rattus norvegicus (Rat)

Glp1r Proteins

Glp1r Proteins for Rattus norvegicus (Rat)

Glp1r ELISA Kit

Glp1r ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.