Recombinant Rat Integrin beta-4(Itgb4),partial

Code CSB-CF727354RAa2
Size US$1235
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names Itgb4
Uniprot No. Q64632
Research Area Signal Transduction
Alternative Names Itgb4; Integrin beta-4; GP150; CD antigen CD104
Species Rattus norvegicus (Rat)
Source in vitro E.coli expression system
Expression Region 28-713aa
Target Protein Sequence SLTENVEEFWDKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYKTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLEEAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDGTHVCQLAKEDQRGNIHLKPSFSDGLRMDASVICDMCACELQKEVQSARCHYRGDFMCGHCVCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYDNFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECGRCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCLPAPS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 92.2 kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Integrin alpha-6/beta-4 is a receptor for laminin. It plays a critical structural role in the hemidesmosome of epithelial cells. Is required for the regulation of keratinocyte polarity and motility. ITGA6
Gene References into Functions
  1. this study suggests that downregulation of integrin beta4 is important for the development ozone stress-induced airway hyperresponsiveness, presumably because it causes increased oxidative damage and epithelial apoptosis. PMID: 20510671
  2. changes in transcription factor, c-Jun and krox-20, and integrin beta4 expression are temporally correlated with the process of demyelination, suggesting roles in regulating the myelin response to CNC injury PMID: 19765400
  3. the SDL segment of the beta4 integrin subunit is required for ligand binding and is involved in outside-in signaling PMID: 12867433
  4. During early stages of myelination, PMP22 and beta4 integrin are coexpressed at the DRG cell surface and can be coimmunoprecipitated together with laminin and alpha6 integrin. PMID: 16436605
Subcellular Location Cell membrane, Single-pass type I membrane protein, Cell membrane, Lipid-anchor, Cell junction, hemidesmosome
Protein Families Integrin beta chain family
Database Links

KEGG: rno:25724

STRING: 10116.ENSRNOP00000059783

UniGene: Rn.198908

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1