Recombinant Rat Melanopsin(Opn4)

Code CSB-CF851271RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8R456
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MNSPSESRVPSSLTQDPSFTASPALLQGIWNSTQNISVRVQLLSVSPTTPGLQAAAWVPF PTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMLIINLAVSDFLMS FTQAPVFFASSLYKKWLFGETGCKFYAFCGAVFGIVSMITLTAIAMDRYLVITRPLATIG MRSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYVTFTPLVRAYTMLLF CFVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRRRQWQRLQSEWKMAKVALIVIL LFVLSWAPYSTVALVGFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRAAIAQ HLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGQKRQESLGSESEVGWTDT ETTAAWGAAQQASGQSFCSHDLEDGEVKAPSSPQEQKSKTPKTKRHLPSLDRRM
Source in vitro E.coli expression system
Gene Names Opn4
Protein Names Recommended name: Melanopsin Alternative name(s): Opsin-4
Expression Region 1-474
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor required for regulation of circadian rhythm. Contributes to pupillar reflex and other non-image forming responses to light. May be able to isomerize covalently bound all-trans retinal back to 11-cis retinal.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Eye; expressed in a photosensitive subset of retinal ganglion cells.
Database Links

KEGG: rno:192223

STRING: 10116.ENSRNOP00000015642

UniGene: Rn.54303

Related Products

Opn4 Proteins

Opn4 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.