Recombinant Rat Orexin receptor type 1 (Hcrtr1)

Code CSB-CF010231RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Hcrtr1
Uniprot No.
Alternative Names
Hcrtr1; Orexin/Hypocretin receptor type 1; Hypocretin receptor type 1; Orexin receptor type 1; Ox-1-R; Ox1-R; Ox1R
Species
Rattus norvegicus (Rat)
Expression Region
1-416
Target Protein Sequence
MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIA LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQA AVMECSSVLPELANRTRLFSVCDERWADELYPKIYHSCFFFVTYLAPLGLMGMAYFQIFR KLWGPQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKML MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF LSGKFREQFKAAFSCCLPGLGPSSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Gene References into Functions
  1. findings suggest that OX1rs in the CA1 region of the hippocampus are involved in the expression of morphine CPP. PMID: 29269074
  2. Results showed that the blockade of Ox1r and Ox2r in the nucleus accumbens (NAc) attenuated the effect of food deprivation (FD) on morphine reinstatement; however, they were more effective in FD condition. Findings indicate that the NAc is a brain area within which orexin has a fundamental role in the effect of stress on morphine-induced reinstatement and the effect of food deprivation- on the reinstatement of morphine. PMID: 29258865
  3. Results suggest that both orexin-1 and -2 receptors in the nucleus accumbens are involved in the development of morphine-induced conditioned place preference. It seems that orexin-1 receptors in this region are more effective in development of drug seeking behaviors in the rats. PMID: 28889006
  4. Study suggests that orexins, via activation of both orexin receptor type 1 and orexin receptor type 2, play a significant role in the expression of NMDA-dependent long-term depression, thereby contributing to the spinal modulation of pain transmission. PMID: 28866050
  5. This evidence sheds light on the role of OX1R in development of morphine dependence in locus coeruleus neurons. PMID: 28888954
  6. Results showed that the postsynaptic modulations of orexin on gigantocellular reticular nucleus reticulospinal neurons were mediated by both orexin-1 and orexin-2 receptors. PMID: 28549933
  7. Suggest that elevated paraventricular nucleus OX1R activation may contribute to salt-sensitive hypertension by enhancing AVP signaling. PMID: 28667055
  8. The results of the present study show upregulation of orexin activity and of the OX1R in the hypothalamus following exposure of rats to footshocks and highlight a specific role of OX1R in contextual fear. PMID: 27575948
  9. Study suggests that the orexin-1 and orexin-2 receptor mediated projections from the lateral hypothalamus to dentate gyrus are involved in the development, expression and extinction of conditioned place preference induced by lateral hypothalamus stimulation PMID: 26987804
  10. Data indicate that ORX signaling at the OX1R receptor specifically regulates high levels of motivation for alcohol, even in the absence of direct alcohol reinforcement. This implicates the ORX system in the pathological motivation underlying alcohol abuse and alcoholism and demonstrates that the OX1R may be an important target for treating alcohol abuse. PMID: 27771284
  11. orexin-A promoted the GLT-1 expression via OX1R/PKCalpha/ERK1/2 pathway in astrocytes and protected co-cultured cells against anoxia/hypoglycemic injury. PMID: 27837432
  12. Findings suggest that OX1 receptors located in the prelimbic cortex and ventral tegmental area are part of a circuit driving cue-mediated ethanol-seeking behaviour. PMID: 25899624
  13. in airway-obstructed animals, enhanced expression of orexin and OX1R plays a role in respiratory induced sleep and growth abnormalities PMID: 26943473
  14. Study indicated that hypothalamic OX1R is upregulated in obesity and this upregulation of OX1R leads to hyperactivity of paraventricular nucleus-spinal neurons and elevated sympathetic vasomotor tone in obesity PMID: 26277341
  15. This study found that hypothalamic pp-orexin/Hcrt mRNA expression and hypothalamic OX1R mRNA expression increased and decreased, respectively, during development in both male and female rats. PMID: 26287582
  16. Median nerve stimulation increases expression levels of the excitatory hypothalamic neuropeptide, orexin-A, and its receptor, OX1R, in the hypothalamic region. PMID: 26059340
  17. Study reveals a direct excitatory action of orexin on inferior vestibular nucleus neurons via co-activation of both postsynaptic OX1 and OX2 receptors PMID: 25371350
  18. Decrease in orexin 1 receptor density and signaling could be involved in tooth pain-induced learning and memory impairment. PMID: 25817882
  19. data suggest that orexinergic projections to the Central Amygdala may contribute to the reinforcing signals facilitating the acquisition of taste learning. PMID: 25223979
  20. Findings show that OxR1 activation regulates operant responding for sucrose reinforcement, but not motivation to work for sucrose or for sucrose-conditioned cues to drive sucrose-seeking in female rats PMID: 25036612
  21. Sympathetic preganglionic neurons were found to be orexin receptor 1 positive and contributed to cardiovascular response to stress. PMID: 25239810
  22. Signaling at orexin receptor 1 in the ventral tegmental area is required for morphine-induced plasticity of dopamine neurons. PMID: 25948277
  23. Hindbrain OX1R activity affects food-motivated operant behavior. PMID: 23978908
  24. Orexin A protects cells from apoptosis by regulating FoxO1 and mTORC1 through the OX1R/PI3K/AKT signaling pathway in hepatocytes. PMID: 24807827
  25. results suggest that orexin-A inhibits reflex swallowing via orexin-1 receptors situated in the commissural part of the nucleus of the solitary tract and/or its vicinity PMID: 24637063
  26. The results indicate that in cultured rat cortical neurons orexin receptors are also coupled to inositol phosphates signaling pathway. PMID: 23744436
  27. OX1R & its mRNA are expressed in C6 glioma cells. Exogenous orexin A, presumably acting at OX1R, does not affect C6 cell proliferation but induces their death through activation of caspase pathway. PMID: 22588980
  28. A major role was determined for orexin-1 receptor and compulsive food consumption in a model of binge eating. PMID: 22569505
  29. Orexin receptor type 1 antagonism reduces heroin self-administration, supporting a role for orexin in cue-triggered drug relapse. PMID: 22356621
  30. Positive stainings of Ox1R in developing spermatocytes, and spermatids of rat testis by immunohistochemistry, are reported. PMID: 22450910
  31. OX1R signaling plays a role in mediating cocaine seeking, but differs between the sexes for cue-induced reinstatement. PMID: 22186370
  32. This study assessed the effects of hindbrain orexin-A and the orexin-1-receptor antagonist SB334867 on meal pattern in rats consuming standard chow. PMID: 21957165
  33. OX1R protein expression was located in the cytoplasm of pancreatic islet beta-cells in rats with alimentary obesity. PMID: 21418915
  34. There are two central nervous system circuits involved in increasing body temperature, heart rate and blood pressure: one circuit activated by muscimol, involving orexin neurons via the orexin-1 receptor. PMID: 21596094
  35. inactivation of dentate gyrus orexin 1 receptors impairs LTP induction in freely moving rats. PMID: 20728473
  36. The results indicate that a modest knockdown of OxR1 is sufficient to induce observable sleep changes. PMID: 21089218
  37. activation of OXR1 in the locus coeruleus might be involved in the expression of withdrawal signs in morphine dependent rats. PMID: 20667500
  38. Orexin A exerts its effects on locomotor behaviour via both OX(1)R and OX(2)R, and agonism or antagonism of only one of these receptors for therapeutic purposes (i.e. sleep disorders) would not provide selectivity in behavioural side effects. PMID: 19889100
  39. findings suggest an important role for the OX-OX1R pathway in STZ-induced experimental diabetes PMID: 20062799
  40. Examine the role of hcrtR1 in nicotine's reinforcing effects. PMID: 20177882
  41. in addition to the well-known regulatory action of the orexins on the reproductive axis, here we demonstrate that sexual steroids also modulate the orexinergic system PMID: 19699765
  42. Neurons containing Orexin 1 receptor immunoreactivity were widely distributed in the hypothalamus PMID: 11849298
  43. Orexin receptor 1 (OX1R) activity was detected in the hypothalamic arcuate, ventromedial, and tuberomammillary nuclei involved in feeding regulation. NPY and proopiomelanocortin arcuate neurons, which stimulate or inhibit feeding, contained OX1R. PMID: 11983281
  44. orexin receptors were present in mitral-tufted cells of the bulb and in many neuronal perikarya in the anterior olfactory nuclei, piriform cortex and amygdala nuclei PMID: 12505657
  45. gonadal steroids differentially regulate pituitary OX(1) receptors and adrenal OX(2) receptors in male and female rats and may contribute to specific sex- dependent neuroendocrine and endocrine actions of orexins. PMID: 12639903
  46. results indicate that orexin A inhibition of the migrating myoelectric complex involves the orexin receptor 1 PMID: 12816759
  47. results provide the first evidence for the regulated expression of orexin 1 receptor mRNA and functional role of orexin-A in the rat testis PMID: 14764632
  48. The orexin 1-receptor is transported in the dense-cored vesicles from the perikarya to axon terminals and OX1R-LI neurons in the dorsal horn of the spinal cord have complex synaptic relationships both with other OX1R-LI neurons. PMID: 15350698
  49. It is suggested that although a severe loss of HCRT leads to narcolepsy, a more modest decline in HCRT could decrease wakefulness and lead to sleepiness during normal wake-active periods. PMID: 15453542
  50. Orexins A and B stimulate insulin secretion from pancreatic cells via Hcrtr1 and Hcrtr2. PMID: 15870901

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in the brain in the prefrontal cortex, hippocampus, paraventricular thalamus, ventromedial hypothalamus, arcuate nucleus, dorsal raphe nucleus, and locus coeruleus. Not detected in the spleen, lung, liver, skeletal muscle, kidney and test
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1