Recombinant Rat Orexin receptor type 1(Hcrtr1)

Code CSB-CF010231RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P56718
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIA LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQA AVMECSSVLPELANRTRLFSVCDERWADELYPKIYHSCFFFVTYLAPLGLMGMAYFQIFR KLWGPQIPGTTSALVRNWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKML MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF LSGKFREQFKAAFSCCLPGLGPSSSARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS
Source in vitro E.coli expression system
Gene Names Hcrtr1
Protein Names Recommended name: Orexin receptor type 1 Short name= Ox-1-R Short name= Ox1-R Short name= Ox1R Alternative name(s): Hypocretin receptor type 1
Expression Region 1-416
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Highly expressed in the brain in the prefrontal cortex, hippocampus, paraventricular thalamus, ventromedial hypothalamus, arcuate nucleus, dorsal raphe nucleus, and locus coeruleus. Not detected in the spleen, lung, liver, skeletal muscle, kidney and test
Database Links

KEGG: rno:25593

STRING: 10116.ENSRNOP00000018674

UniGene: Rn.88262

Related Products

Hcrtr1 Proteins

Hcrtr1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.