Recombinant Rat Orexin receptor type 2 (Hcrtr2)

Code CSB-CF010232RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Hcrtr2; Orexin receptor type 2; Ox-2-R; Ox2-R; Ox2R; Hypocretin receptor type 2
Species
Rattus norvegicus (Rat)
Expression Region
1-460
Target Protein Sequence
MSSTKLEDSLPRRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVS CIIMIPQAIVMERSSMLPGLANKTTLFTVCDERWGGEVYPKMYHICFFLVTYMAPLCLMV LAYLQIFRKLWCRQIPGTSSVVQRKWKQPQPVSQPRGSGQQSKARISAVAAEIKQIRARR KTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFSHWLVYANSAAN PIIYNFLSGKFREEFKAAFSCCLGVHRRQGDRLARGRTSTESRKSLTTQISNFDNVSKLS EHVALTSISTLPAANGAGPLQNWYLQQGVPSSLLSTWLEV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Gene References into Functions
  1. Study using specific orexin receptor antagonists suggests that the orexin 2 receptor has a dominant role in the observed effects of orexin A/hypocretin-1 . To our knowledge, this article is the first to show orexinergic modulation of the ventrolateral geniculate nucleus . PMID: 26724374
  2. the OX2 receptor has a critical role in modulating reward circuit in the Ventral Tegmental Area and Nucleus Accumbens PMID: 26494513
  3. Activation of orexin perifornical hypothalamus-rostral ventrolateral medulla (RVLM) neurons and orexin type 2 receptors in the RVLM facilitates epinephrine release by increasing sympathetic drive to adrenal chromaffin cells during hypoglycemia. PMID: 26653571
  4. Orexin 2 receptor (and orexin 1 receptor) contribute to the cardiovascular and locomotor response to stress. PMID: 25239810
  5. Orexins modifiy orexin receptor gene expression and gonadotropin release from the anterior pituitary gland. PMID: 24333629
  6. Elevated OX2R-mediated activity in the brain. PMID: 23525245
  7. Suggest a more prominent role for OX(2)R in ethanol self-administration compared to cue-conditioned ethanol-seeking. PMID: 23601187
  8. siRNA knockdown of OX2R in pontomesencephalic tegmentum increases duration of REM episodes. PMID: 23282008
  9. OX2R protein and mRNA are expressed in C6 glioma cells. PMID: 22588980
  10. In cultured rat cortical neurons, acting at OX2 receptors coupled to Gi protein, orexin inhibits cyclic AMP synthesis. PMID: 21547533
  11. These results demonstrate that orexins excite the cerebellar IN neurons through OX(2)R and suggest that the central orexinergic nervous system may actively participate in motor control through its modulation of the final outputs of the spinocerebellum PMID: 19921532
  12. Examine the role of hcrtR2 in nicotine's reinforcing effects. PMID: 20177882
  13. In developing hypoglossal motoneurons dissociated from 4-to 33-day-old rats, the number of mRNA copies of the orexin type 2 receptor identified per cell is significantly higher around day 20 postnatally than at any other age. PMID: 11930155
  14. Orexin Stimulation of amylase release by a pancreatic cell line is mediated by Orexin 2 receptors. PMID: 12409837
  15. Two distinct clusters of neurons containing orexin-B immunoreactivity within the amygdaloid complex may serve as a component of neuronal circuits involved in integrating complex homeostatic mechanisms associated with behaviors in the rat. PMID: 12650973
  16. Deterioration of the orexin system may play a role in the phenomenon associated with aging. PMID: 14749141
  17. Hypocretin, via the Hcrtr2 receptor, affects a specific subset of somatosensory cortex layer 6b neurons which, through corticocortical projections, may also be involved in promoting widespread cortical activation. PMID: 15282280
  18. hypocretins have roles in driving drug seeking through activation of stress pathways in the brain PMID: 16357203
  19. Thwe Ox2R signaling pathway was studied in rat olfactory mucosa and olfactory afferent neurons. PMID: 17292491
  20. Data suggest that muscarininc-2 and orexin-2 receptors may determine behavioral and state-regulating roles of GABA- and non-GABAergic neurons of the mesopontine reticular formation and lateral tegmentum and their dysfunction in narcolepsy with cataplexy. PMID: 18709662
  21. These results support a dual role for oxB/hcrt-2 in mediating glutamatergic transmission in the VTA, and suggest that oxA/hcrt-1 and oxB/hcrt-2 exert different roles in enhancing the motivational components of arousal and feeding. PMID: 18793323
  22. Biochemical and behavioural characterization of EMPA, a novel high-affinity, selective antagonist for the OX(2) receptor. PMID: 19751316
  23. Orexin receptor expression was studies in various tissues. OX2R is sexually dimorphic expressed in adrenal glands. PMID: 11459774

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the brain in the cerebral cortex, septal nuclei, hippocampus, medial thalamic groups, dorsal and median raphe nuclei, and many hypothalamic nuclei including the tuberomammillary nucleus, dorsomedial hypothalamus, paraventricular hypothalamic
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1