Recombinant Rat Potassium voltage-gated channel subfamily E member 2(Kcne2)

Code CSB-CF012027RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P63161
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
Source in vitro E.coli expression system
Gene Names Kcne2
Protein Names Recommended name: Potassium voltage-gated channel subfamily E member 2 Alternative name(s): MinK-related peptide 1 Minimum potassium ion channel-related peptide 1 Potassium channel subunit beta MiRP1
Expression Region 1-123
Tag Info 10xHis-SUMO-tag
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Potassium channel KCNE family
Tissue Specificity Expressed in the heart (PubMed:19219384).
Database Links

KEGG: rno:171138

STRING: 10116.ENSRNOP00000045279

UniGene: Rn.48691

Related Products

Kcne2 Antibodies

Kcne2 Antibodies for Rat

Kcne2 Antibodies for Rattus norvegicus (Rat)

Kcne2 Proteins

Kcne2 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.