Recombinant Rat Prostaglandin E2 receptor EP4 subtype(Ptger4)

Code CSB-CF018973RA
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Ptger4
Uniprot No. P43114
Alternative Names Ptger4Prostaglandin E2 receptor EP4 subtype; PGE receptor EP4 subtype; PGE2 receptor EP4 subtype; Prostanoid EP4 receptor
Species Rattus norvegicus (Rat)
Expression Region 1-488
Target Protein Sequence MSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG LAVTDLLGTLLVSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSIICAMSIERYLA INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGRSERQYPGTWCFIDWTTNVTA YAAFSYMYAGFSSFLILATVLCNVLVCGALLRMLRQFMRRTSLGTEQHHAAAAAAVASVA CRGHAAASPALQRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFINQL YQPSVVKDISRNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSGRD GSAQHCSESRRTSSAMSGHSRSFLSRELREISSTSHTLLYLPDLTESSLGGKNLLPGTHG MGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSQREEPASKGNSLQVTFPSET LKLSEKCI
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
Gene References into Functions
  1. We found that rats injected with the 30mug dose of PGE2 exhibited the most pronounced thermal nociceptive hypersensitivity though secondary analysis showed that rats injected with PGE2 doses of 0.03-30mug had lower withdrawal latencies as compared to rats injected with vehicle. PMID: 29031391
  2. Data suggest that EP4 recycling contributes to agonist-induced cell surface abundance and consequently enhanced receptor sensitivity. Facilitating EP4 externalization and recycling is a novel mechanism underlying PGE2-induced nociceptor sensitization. PMID: 27060485
  3. PGE2 uses different receptors and mechanisms to ultimately decrease MMP expression and fibroblast migration. PMID: 25263346
  4. These studies demonstrate, for the first time, that BBR exerts renoprotective effects in different stages of DN via EP4- Galphas- AC-cAMP signaling pathway in STZ-induced DN rats fed a high-sugar and high-fat diet. PMID: 24849498
  5. Our findings identify vascular PGE2 signaling through its EP4 receptor as protective in hypoxic-ischemic encephalopathy. PMID: 24560715
  6. The EP(4) receptor was seen in the dorsal root ganglion in rats PMID: 22061836
  7. EP4 receptors were expressed in forebrain neurons & were induced in endothelial cells after hypoxic-ischemic injury in the neonatal rat. Activation by misoprostol reduced the injury. PMID: 21939736
  8. In collagen arthritis paeoniflorin inhibited synoviocyte function and regulated immune cells responses, which might be related to its regulatory effect on the up-regulation of EP4 receptor protein. PMID: 21840386
  9. the expression of prostaglandin E(2) (EP(4)) and prostacyclin (IP) receptors in cultures of mixed dorsal root ganglia cells and in purified dorsal root ganglia glia PMID: 21549696
  10. Effects of selective prostaglandin EP4 receptor antagonist on osteoclast formation and bone resorption in vitro. PMID: 11792579
  11. EP4 receptor is important PGE receptor subtype in inflammatory conditions of the colonic mucosa, and mediate the anti-inflammatory actions of PGE2 PMID: 12100473
  12. PGE2 induces wakefulness through activation of the histaminergic system via EP4 receptors PMID: 12853415
  13. Expression regulated in cervix and peaks on day of parturition. Genomic structure of human and rat EP4 gene conserved. GC rich/Sp1 binding site located within first 80 bases of transcription start site important in transcription initiation of EP4 gene. PMID: 14634592
  14. EP4 receptors are involved in duodenal HCO(3)(-) response induced by PGE(2) or acidification. Stimulation through EP4 receptors is mediated by cAMP. PMID: 15194560
  15. Lipopolysaccharide-induced production of inflammatory mediators and cardiovascular depression were attenuated by EP4 agonist administration in an in vivo endotoxin shock model. PMID: 15201706
  16. PGE(2) increases renal pelvic release of substance P and afferent renal nerve activity by activating EP4 receptors on renal sensory nerve fibers PMID: 15292051
  17. PGE2 induces protein synthesis in cardiac myocytes in part via activation of the EP4 receptor and subsequent activation of p42/44 MAPK. PMID: 15626689
  18. signals through EP4 have 2 essential roles in ductus arteriosus development, namely, vascular dilation and intimal cushion formation PMID: 17080198
  19. These data provide evidence of the role of prostaglandins in the pathogenesis of neuropathic pain, and suggest that not only infiltrating macrophages but also Schwann cells may be involved in the modulation of these mediators in response to nerve injury. PMID: 17110143
  20. These results confirmed the importance of COX-2/PGE2 in the healing mechanism of gastric ulcers and further suggested that the healing-promoting action of PGE2 is mediated by the activation of EP4 receptors and is associated with VEGF expression. PMID: 17673547
  21. Results suggest that PGE2 stimulates VEGF expression in gastric fibroblasts through the activation of EP4 receptors, and this effect may be involved in the healing promoting action of PGE2 on gastric ulcers. PMID: 17943254
  22. Hypertonicity stimulates PGE2 signaling in the renal medulla by promoting Ptger4 expression. PMID: 18843255

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: rno:84023

STRING: 10116.ENSRNOP00000017886

UniGene: Rn.16062

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1