Recombinant Rat Smoothened homolog (Smo)

Code CSB-CF021841RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Smo; Smoh; Smoothened homolog; SMO
Species
Rattus norvegicus (Rat)
Expression Region
31-793
Target Protein Sequence
RGAALSGNVTGPGPRSAGGSARRNAPVTSPPPPLLSHCGRAAHCEPLRYNVCLGSALPYG ATTTLLAGDSDSQEEAHSKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTL CQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPKSW YEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVI LFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRFGEPTSSETLSCVIIFVIVYYALM AGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSV SGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKIN ETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKKPIPD CEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGHSDDEPKRIKKS KMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFELNEPSADVSSAWAQHVTKMV ARRGAILPQDVSVTPVATPVPPEEQANLWLVEAEISPELEKRLGRKKKRRKRKKEVCPLG PAPELHHSAPVPATSAVPRLPQLPRQKCLVAANAWGTGEPCRQGAWTVVSNPFCPEPSPH QDPFLPGASAPRVWAQGRLQGLGSIHSRTNLMEAELLDADSDF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7, GLI2 and GLI3 in the cilia. Interacts with DLG5 at the ciliary base to induce the accumulation of KIF7 and GLI2 at the ciliary tip for GLI2 activation.
Gene References into Functions
  1. This study characterizes, for the first time, the transcriptional response of cardiomyocytes to Shh and establishes a critical role for Smo coupling to Gi in Hh signaling in the normal and ischemic myocardium PMID: 24816261
  2. The expression of Shh, Smo and Gli1 at the protein and mRNA level in hepatocytes of rats with chronic fluorosis can be increased by fluoride and may be inhibited by cyclopamine. PMID: 24388991
  3. Ptch1 and Smo are predominantly localized in the postsynaptic side of the synapses, a distribution pattern similar to that found in hippocampal neurons PMID: 22477363
  4. In young rat hippocampal neurons, Smo is present in the processes and growth cones. In mature rat hippocampal neurons, Smo is located predominately in dendrites, dendritic spines, and postsynaptic sites. PMID: 21618238
  5. Shh and Smo are upregulated in a time-dependent manner in retinas exposed to ocular hypertension, and Shh has neuroprotective effects on damaged RGCs in a rat chronic hypertension model. PMID: 20071678
  6. Facial nerve axotomy upregulates Sonic hedgehog (Shh) and its receptor Smoothened (Smo) in facial motor neurons of adult rats, whereas facial nerve axotomy does not upregulate mRNA of Shh or Smo in neonatal rats. PMID: 15356205

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.
Protein Families
G-protein coupled receptor Fz/Smo family
Tissue Specificity
In embryo, found in the early neural folds and neural tube, pre-somitic mesoderm and somites, developing limb bud, gut, eye, testes, cartilage, muscle, lung, epiglottis, thymus, tongue, jaw, taste buds, teeth, and skin. In adult, found in multiple tissues
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1