Recombinant Rat Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1)

Code CSB-CF002326RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Atp1b1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1
Species
Rattus norvegicus (Rat)
Expression Region
1-304
Target Protein Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGSMPSEPKERGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPLTMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGFYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.; Involved in cell adhesion and establishing epithelial cell polarity.
Gene References into Functions
  1. Data show that Na(+)/K(+)-ATPase's DR-region specific monoclonal antibody and direct activator DRm217 increased Na(+)/K(+)-ATPase activity and alleviated Ca(2+) level. PMID: 27563007
  2. Amino acid region (198-207) is crucial for both trans-dimerization of the Na+/K+-ATPase beta1 subunits and cell-to-cell adhesion. PMID: 22328500
  3. interactions between the beta subunits of neighboring cells maintain integrity of intercellular junctions PMID: 21642423
  4. analysis of pathways for maturation of the Na,K-ATPase beta1 and beta2 subunits in the endoplasmic reticulum PMID: 20937802
  5. Data demonstrate that Na(+),K(+)-ATPase beta 1 subunits have sufficient proximity and affinity to permit a direct interaction, without requiring any additional extracellular molecules to span the distance. PMID: 20444976
  6. FXYD7 decreases the apparent K(+) affinity of rat alpha 1-beta 1 and alpha 2-beta 1, but not of alpha 3-beta1 isozymes. PMID: 12093728
  7. expression of Na/K ATPase beta1 subunit mRNA was transiently increased in astrocytes after reoxygenation, whereas hypoxia itself did not induce any gene expression change PMID: 12573531
  8. glucocorticoids directly stimulate transcription of Na+-K+-ATPase beta1 gene expression in adult rat lung epithelial cells through a GR-dependent mechanism that can act at multiple sites. PMID: 12754184
  9. the 143-nt segment in the distal segment of the 3'-UTR of beta1 mRNA may play an important role in the control of beta1-subunit expression. PMID: 14761885
  10. beta(1)-Na(+),K(+)-ATPase is likely to represent the most physiologic and efficient subunit for HKalpha(2) assembly in distal colon. PMID: 15327400
  11. the the TM domain of FXYD7 has a role in mediating the complex interactions of FXYD7 with Na,K-ATPase PMID: 16269407
  12. after an ischaemic, insult alpha1 and beta1 protein subunit abundance and mRNA levels are independently regulated. PMID: 16708288
  13. Spermidine induction of Atp1b1 in small intestine may be mediated by altered ornithine decarboxylase expression. PMID: 17673438
  14. the ER quality control system allows export only of assembled alpha-beta complexes to the Golgi, whereas the number of alpha(1) subunits in the ER determines the amount of the alpha-beta complexes PMID: 19764716

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.
Protein Families
X(+)/potassium ATPases subunit beta family
Tissue Specificity
Expressed in the brain, liver, testes and anterior prostate (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1