Recombinant Rat T-cell surface glycoprotein CD5(Cd5)

Code CSB-CF004942RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P51882
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence QSGRGFVGAQVMLSGSNSKCQGLVEVQMNGMKTVCSSSWRLSQDLWKNANEASTVCQQLGCGNPLALGHLTLWNRPKNQILCQGPPWSFSNCSTSSLGQCLPLSLVCLEPQKTTPLPTTTLPTTMPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSRGGTILYKAKARPVDLGNLICKSLQCGSFLTHLSRIETAGTPAPAELRDPRPLPIRWEAQNGSCTSLQQCFQKTTVQEGSQALAVVCSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWAALCDSSAARGPGRWEELCQEQQCGNLISFHVMDADRTSPGVLCTQEKLSQCYQLQKKTHCKRVFITCKDPNPVGLAPGTVASIILTLVLLVVLMVMCGPLIYKKLVKKFRQKKQRQWIGPTGVNQSMSFHRSHTATVRSQVENPAASHVDNEYSQPPRNSRLSAYPALEGALHRSSTQPDNSSDSDYDLQVAQRL
Source in vitro E.coli expression system
Gene Names Cd5
Protein Names Recommended name: T-cell surface glycoprotein CD5 Alternative name(s): CD_antigen= CD5
Expression Region 24-491
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act as a receptor in regulating T-cell proliferation.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Database Links

KEGG: rno:54236

STRING: 10116.ENSRNOP00000051697

UniGene: Rn.11337

Pathway Hematopoietic cell lineage

Related Products

Cd5 Proteins

Cd5 Proteins for Rattus norvegicus (Rat)

Cd5 ELISA Kit

Cd5 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.