Recombinant Rat Thyrotropin receptor(Tshr)

Code CSB-CF025131RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Tshr
Uniprot No. P21463
Alternative Names Tshr; Thyrotropin receptor; Thyroid-stimulating hormone receptor; TSH-R
Species Rattus norvegicus (Rat)
Expression Region 22-764
Target Protein Sequence RGCTSPPCECHQEDDFRVTCKELHQIPSLPPSTQTLKLIETHLKTIPSLAFSSLPNISRI YLSIDATLQRLEPHSFYNLSKMTHIEIRNTRSLTYIDPDALTELPLLKFLGIFNTGLRIF PDLTKIYSTDVFFILEITDNPYMTSVPENAFQGLCNETLTLKLYNNGFTSIQGHAFNGTK LDAVYLNKNKYLTAIDKDAFGGVYSGPTLLDVSSTSVTALPSKGLEHLKELIAKNTWTLK KLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLMCNESSIRNLRQRKSVNVMRGP VYQEYEEGLGDNHVGYKQNSKFQEGPSNSHYYVFFEEQEDEIIGFGQELKNPQEETLQAF DSHYDYTVCGDNEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSPMALLGNVFVLFVLLT SHYKLTVPRFLMCNLAFADFCMGVYLLLIASVDLYTHTEYYNHAIDWQTGPGCNTAGFFT VFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHAYTIMAGGWVSCFLLALLPMVGIS SYAKVSICLPMDTDTPLALAYIALVLLLNVVAFVIVCSCYVKIYITVRNPQYNPRDKDTK IAKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSGVLLVLFYPLNSCANPFLYAIF TKAFQRDVFILLSKFGLCKHQAQAYQAQRVCPNNNTGIQIQKIPQDTRQSLPNVQDTYEP LGSSHLTPKLQGRISEEYTQTAL
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the thyroid-stimulating hormone (TSH) or thyrotropin. Also acts as a receptor for the heterodimeric glycoprotein hormone (GPHA2:GPHB5) or thyrostimulin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Plays a central role in controlling thyroid cell metabolism.
Gene References into Functions
  1. Data suggest that functional thyroid-stimulating hormone receptor is present in the caudal brainstem and hypothalamic nuclei of relevance for feeding control as a possibly uncleaved holoreceptor, and highlights a hindbrain component to central thyroid-stimulating hormone inhibition of food intake. PMID: 27059392
  2. TSH signal transduction in cultured tanycytes signals via G alphas to increase cAMP via an alternative G protein to increase phosphorylation of ERK1/2. PMID: 25878058
  3. Results show that Tshr mRNA levels were up-regulated during differentiation of brown adipocytes. During the differentiation of brown adipocytes PMID: 25662278
  4. Higher TSH level in the BN strain appears to reflect an adjustment of the feedback loop to reduced thyrocyte sensitivity to TSH secondary to reduced TSHR expression. PMID: 17640981
  5. TSHR is present and functional in hepatocytes. PMID: 19187127
  6. Data indicate that the presence of thyrostimulin in the ovary suggests that it may have a primitive function in reproduction when it activates ovarian TSHR. PMID: 19955180
  7. Developmental profiles of TSH, sex steroids, and their receptors in the thyroid and their relevance to thyroid growth in immature rats PMID: 11755178
  8. Identical amino acid residues in homologous receptors can exhibit distinct functions. Role of ionic strength (Na+) on signaling differs in the three receptors. PMID: 12588044
  9. mutation effects vary with the ambient iodide supply and could be masked in regions of high iodine intake PMID: 15691889

Show More

Hide All

Subcellular Location Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database Links

KEGG: rno:25360

STRING: 10116.ENSRNOP00000005671

UniGene: Rn.87913

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1