Recombinant Saccharomyces cerevisiae Mitochondrial metalloendopeptidase OMA1(OMA1)

Code CSB-CF339648SVG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P36163
Storage Buffer Tris-based buffer,50% glycerol
Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Sequence MLRNIIRFKGFGKGTSGGFLKPVSFRVQLTRCYRYDNGPSYRRFNNGEYSQKSSFKSILL DKSSRKYLALLFGGCSLFYYTHLDKAPVSDRSRFIWVSRPLELTIGNYTYKSIWRQTQQE ILPPQHPLSIKIENIFMKIVEAAYKDPSVDNSLLDGIKWEIHVVNDPTASPNAFVLPGGK VFIFSSILPICANDDGIATVLAHEFAHQLARHTAENLSKAPIYSLLGLVLYTVTGAHAIN NILLDGFLRMPASRQMETEADYIGLMIMSRACFQPQESIKVWERMANFEKQMNRGGVVNM EFLSTHPASTRRIENMSKWLPKANEIYEQSDCSSMGNYYKSFFSM
Source in vitro E.coli expression system
Gene Names OMA1
Protein Names Recommended name: Mitochondrial metalloendopeptidase OMA1 EC= 3.4.24.-
Expression Region 1-345
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Protease that is part of the quality control system in the inner membrane of mitochondria. Cleaves and thereby promotes the turnover of mistranslated or misfolded membrane proteins. Can cleave the misfolded multi-pass membrane protein OXA1.
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Peptidase M48 family
Database Links

KEGG: sce:YKR087C

STRING: 4932.YKR087C

Related Products

OMA1 Antibodies

OMA1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

OMA1 Proteins

OMA1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.