Recombinant Sheep Gonadotropin-releasing hormone receptor (GNRHR)

Code CSB-CF009637SH
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
GNRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R
Species
Ovis aries (Sheep)
Expression Region
1-328
Target Protein Sequence
MANGDSPDQNENHCSAINSSILLTPGSLPTLTLSGKIRVTVTFFLFLLSTIFNTSFLLKL QNWTQRKEKRKKLSKMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGM IHLADDSGQTEGFSQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLLIMLICNAKIIFTLTR VLHQDPHKLQLNQSKNNIPQARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPDMVNRV SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. data suggest that decrease in LH secretion during the long photoperiod in sheep may be due to low translational activity of genes encoding both GnRH and GnRHR. PMID: 27901351
  2. These results suggested that beta-endorphinergic system in the hypothalamus of follicular-phase ewes affects directly or via beta-endorphin-sensitive interneurons GnRH and GnRHR biosynthesis leading to suppression in secretory activity of the hypothalamic-pituitary axis. PMID: 27335238
  3. These results indicate that the disturbances of gonadotropin secretion under stress conditions in sheep may be due to a dysfunction of GnRH and GnRHR biosynthetic pathways. PMID: 27629353
  4. Data indicate that ESR1 on plasma membrane surface is likely candidate for mediating E2 up-regulation of GNRHR expression in pituitary cells; this signaling mechanism proceeds through CREB-dependent pathway. PMID: 21734267
  5. LPS injections decrease GnRH and GnRHR genes expression in brain. PMID: 20427135
  6. Short as well as prolonged stress stimuli caused an increase in GnRH-R mRNA levels in the hypothalamus and pituitary. PMID: 17435833
  7. cortisol acts via the type II glucocorticoid receptor within the pituitary gland to elicit a rapid decrease in responsiveness to GnRH, independent of changes in expression of the GnRH receptor PMID: 17962347
  8. Infusion of sulpiride into the third ventricle increases GnRH mRNA levels in the anterior pituitary gland. PMID: 18528813

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

KEGG: oas:443413

UniGene: Oar.486

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1