Recombinant Xenopus tropicalis Apelin receptor(aplnr)

Code CSB-CF001910XBF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4VA82
Storage Buffer Tris-based buffer,50% glycerol
Species Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Sequence MATDEFSSSTTPSYDYYDYTNESGLPPCDETDWDLSYSLLPVFYMIVFVLGLSGNGVVIF TVWKAKPKRRSADTYIGNLALADLAFVVTLPLWATYTALGFHWPFGSALCKLSSYLVLLN MFASVFCLTCLSFDRYLAIVHSLSSAKLRSRSSILVSLAVIWLFSGLLALPSLILRDTRV EGNNTICDLDFSGVSSKENENFWIGGLSILTTVPGFLLPLLLMTIFYCFIGGKVTMHFQN LKKEEQKKKRLLKIIITLVVVFAICWLPFHILKTIHFLDLMGFLELSCSTQNIIVSLHPY ATCLAYINSCLNPFLYAFFDLRFRSQCFFFFGFKKALQGHLSNTSSSLSAQTQKSEIHSL ATKV
Source in vitro E.coli expression system
Gene Names aplnr
Protein Names Recommended name: Apelin receptor Alternative name(s): Angiotensin receptor-like 1 Angiotensin receptor-related protein G-protein coupled receptor APJ
Expression Region 1-364
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for apelin receptor early endogenous ligand (apela) and apelin (apln) hormones coupled to G proteins that inhibit adenylate cyclase activity. Plays a key role in early development such as gastrulation and heart morphogenesis by acting as a receptor for apela hormone, promoting endoderm and mesendoderm cell migration and regulating the migration of cells fated to become myocardial progenitors, respectively. Required for cardiovascular development, particularly for intersomitic vein angiogenesis. Plays also a role in various processes in adults such as regulation of blood vessel formation, blood pressure, heart contractility, and heart failure. Acts upstream of the i/o type of G-alpha proteins in the differentiation of endothelium, erythroid cells, myeloid cells and cardiomyocytes.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: xtr:613084

UniGene: Str.52125

Pathway Apelin signaling pathway

Related Products

aplnr Proteins

aplnr Proteins for Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.