Recombinant Human Tumor necrosis factor ligand superfamily member 11(TNFSF11),partial (Active)

In Stock
Code CSB-AP004851HU
Product Type Tumor Necrosis Factor
Size $195Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. O14788
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Alias CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteoclast differentiation factor; Receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor ligand superfamily member 11
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to binding SF11A used funtional ELISA is less than 10 ug/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Research Area Cancer
Source E.coli
Gene Names TNFSF11
Expression Region 140-317aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 22.4 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy
Involvement in disease Osteopetrosis, autosomal recessive 2 (OPTB2)
Subcellular Location Isoform 1: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 11, soluble form: Secreted
Protein Families Tumor necrosis factor family
Tissue Specificity Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid.
Database Links

HGNC: 11926

OMIM: 259710

KEGG: hsa:8600

STRING: 9606.ENSP00000239849

UniGene: Hs.333791

Pathway NF-kappa B signaling pathway
Osteoclast differentiation

Related Products

TNFSF11 Antibodies

TNFSF11 Antibodies for Homo sapiens (Human)

TNFSF11 Antibodies for Human

TNFSF11 Proteins

TNFSF11 Proteins for Homo sapiens (Human)

TNFSF11 ELISA Kit

TNFSF11 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.