Recombinant Human Glutathione S-transferase kappa 1 (GSTK1), partial

In Stock
Code CSB-EP009978HU
Abbreviation Recombinant Human GSTK1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
GSTK1
Target Names
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
EC 2.5.1.18; Glutathione S Transferase kappa 1; Glutathione S transferase subunit 13; Glutathione S-transferase k1; Glutathione S-transferase kappa 1; Glutathione S-transferase subunit 13; Glutathione S-transferase subunit 13 homolog; GST 13 13; GST 13-13; GST; GST class kappa; GST class-kappa; GST13; GST13-13; GSTK1 1; Gstk1; GSTK1-1; GSTK1_HUMAN; hGSTK1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-226aa
Target Protein Sequence
GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Mol. Weight
52.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Glutathione S-transferase kappa 1 (GSTK1) is produced in E. coli and covers the 2-226 amino acid region, representing a partial protein sequence. The product includes an N-terminal GST tag, which helps with purification and detection during experiments. SDS-PAGE analysis shows the protein reaches purity levels above 90%, making it high-quality material for research work. This product is strictly for research use and cannot be applied in diagnostic or therapeutic settings.

Glutathione S-transferase kappa 1 (GSTK1) appears to be an enzyme that participates in cellular detoxification processes. It seems to help catalyze the conjugation of glutathione to different substrates, which may aid in breaking down toxins and carcinogens. GSTK1 belongs to the larger glutathione S-transferase family - enzymes that are likely critical for cellular defense and have drawn significant research attention for their roles in drug resistance and metabolic pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant human GSTK1 protein is expressed in E. coli as a partial sequence (2-226aa) with an N-terminal GST tag, and its bioactivity is unknown. The GST tag (≈26 kDa) is large and may sterically hinder the native structure or active site of GSTK1, potentially leading to misfolding or loss of function. Since no activity data is provided, the protein cannot be assumed to be correctly folded or bioactive without validation. The purity (>90%) is acceptable for some applications, but the unknown activity status requires caution in interpreting results.

1. Enzyme Activity and Kinetic Studies

This recombinant GSTK1 is not suitable for enzyme activity studies without prior validation of bioactivity, as the unknown activity and large GST tag may interfere with substrate binding or catalytic function. The GST tag could alter kinetic parameters or block the active site, leading to inaccurate measurements. Researchers should first confirm GSTK1 activity using a standard glutathione conjugation assay before attempting kinetic studies. Even if active, results may not reflect native GSTK1 due to the tag.

2. Protein-Protein Interaction Studies

The GST-tagged GSTK1 can be used for pull-down assays via GST immobilization, but the partial sequence and unknown activity raise concerns about physiological relevance. Identified interactions may be artifacts of the tag or misfolding. Researchers should validate any novel interactions with full-length, tag-free GSTK1 in cellular contexts. The GST tag itself may cause non-specific binding, requiring stringent controls (e.g., GST-alone controls).

3. Antibody Development and Validation

This protein can serve as an antigen for antibody generation, but the GST tag may dominate the immune response, producing antibodies against GST rather than GSTK1-specific epitopes. Antibodies should be validated against tag-free GSTK1 to ensure specificity. The partial sequence (lacking the N-terminal region) may also limit epitope coverage, so full-length GSTK1 should be used for comprehensive validation.

4. Structural and Biophysical Analysis

The protein is of sufficient purity for biophysical studies, but the large GST tag may impede structural determination by crystallography or NMR due to size and flexibility. The unknown activity suggests possible misfolding. For meaningful structural insights, the GST tag should be removed, and activity confirmed first. Techniques like circular dichroism could assess folding, but results may not represent native GSTK1.

5. Inhibitor Screening and Drug Discovery Research

This protein is not recommended for inhibitor screening without confirmed activity, as the GST tag may alter inhibitor binding sites, leading to false positives/negatives. The unknown bioactivity means any hits may not target functional GSTK1. If activity is validated, screen with caution and confirm hits using tag-free protein or cellular assays.

Final Recommendation & Action Plan

This recombinant GSTK1 with an N-terminal GST tag and unknown activity should be used with caution. First, prioritize validating its bioactivity using a standard glutathione conjugation assay to confirm it functions as GSTK1. If active, it can be used for limited applications: for pull-down studies, the GST tag is beneficial for immobilization, but always include GST-alone controls; for antibody development, use it for immunization but rigorously screen for GSTK1-specific clones against tag-free protein. Avoid enzyme kinetics, structural studies, or inhibitor screening until activity is confirmed, and even then, be aware that the GST tag may distort results. For most applications, consider using a tag-free or cleavable-tag version of full-length GSTK1 for physiological relevance. The purity (>90%) is adequate, but low for sensitive assays; repurification may be needed. Always include appropriate controls to account for tag-related artifacts.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).
Gene References into Functions
  1. Several biological properties of the GST-hNdCTR1 fusion protein were assessed. It was demonstrated that in cells, the protein was prone to oligomerization, formed inclusion bodies and displayed no toxicity. Treatment of E. coli cells with copper and silver ions reduced cell viability in a dose- and time-dependent manner PMID: 29099786
  2. we confirmed several existing chemoinformatic filters and more importantly extended them as well as added novel filters that specify compounds with anti-GST/GSH activity. Selected compounds were also tested using different antibody-based GST detection technologies and exhibited no interference clearly demonstrating specificity toward their GST/GSH interaction. PMID: 27044684
  3. Our findings indicate that the medical staff exposed to low IR levels were under risk of significant oxidative stress that was enhanced by their glutathione S-transferase (GST) polymorphisms. PMID: 28287017
  4. GSTK1 T/T genotype may be a novel risk factor for the prediction of overweight status in SCZ male patients. PMID: 27010189
  5. High glutathione-S-transferase is associated with type 2 diabetes mellitus. PMID: 27377684
  6. DsbA-L is localized in both the mitochondria and the endoplasmic reticulum (ER) in adipocytes; its ER localization plays a critical role in suppressing ER stress and promoting adiponectin biosynthesis and secretion. PMID: 25739441
  7. we have optimized the GST-Nck1-SH2 pull-down procedure to obtain tyrosine-phosphorylated proteins in tumor tissues PMID: 23426619
  8. drug resistance in three strains of tumor cells is associated with significant increase in hGSTP1 and hGSTA4 gene expression, whereas increased hGSTK1 gene expression was detected only in resistant erythroleukemia and mammary adenocarcinoma cells. PMID: 23330092
  9. This study does not give evidence of interaction between the GST polymorphisms and smoking may although this study provided sufficient statistical power to detect modest interaction. PMID: 20472488
  10. SNP-1308G/T (rs1917760) genotypes of DsbA-L gene might participate in insulin secretion and body fat distribution. It is possible that polymorphisms of DsbA-L gene associated with metabolic diseases[DsbA-L] PMID: 19225211
  11. structure and function characterization of a GST from human breast PMID: 14709161
  12. Gene and protein characterization; its subcellular localization in peroxisomes, suggesting a new function for this family of enzymes [glutathione S-transferase kappa (hGSTK1)] PMID: 14742434
  13. crystal structure of hGSTK1 has been determined by the multiple-isomorphous replacement method and refined to 1.93 A resolution PMID: 16081649
  14. Our results suggest that genetic polymorphisms of xenobiotic-metabolizing enzymes could play an important role in infertility. PMID: 18774560
  15. The objective of this study was to investigate the molecular mechanisms underlying Group B Streptococcus-human umbilical vein endothelial cells interaction, focusing specifically on the responsiveness of host protein tyrosine kinase (PTK). PMID: 19639233
  16. Observational study of gene-disease association. (HuGE Navigator) PMID: 19225211
  17. Observational study of gene-disease association. (HuGE Navigator) PMID: 17601350
  18. Presence of hGSTK1 in both peroxisomes and mitochondria. The C-terminus of hGSTK1 is essential for localization of the protein to peroxisomes, and the C-terminal sequence Ala-Arg-Leu represents a peroxisome targeting signal 1 (PTS1). PMID: 14742434

Show More

Hide All

Subcellular Location
Peroxisome.
Protein Families
GST superfamily, Kappa family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 16906

OMIM: 602321

KEGG: hsa:373156

UniGene: Hs.390667

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*