Register | Sign In Professional and Accurate! We are your good partner in biology research.
cusabio

Product Name:

Recombinant Mouse C-X-C motif chemokine 9(Cxcl9)

Product Type : Recombinant Protein
Code : CSB-RP092694m
Size : Pls inquiry other sizes
Uniprot NO. : P18340
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Relevance : May be a cytokine that affects the growth, movent, or activation state of cells that participate in immune and inflammatory response.
References : A macrophage mRNA selectively induced by gamma-interferon encodes a member of the platelet factor 4 family of cytokines.Farber J.M.Proc. Natl. Acad. Sci. U.S.A. 87:5238-5242(1990)
Storage Buffer : Tris-based buffer,50% glycerol
Alias : Gamma-interferon-induced monokine;Monokine induced by interferon-gamma ;MIG ;MuMIGProtein m119Small-inducible cytokine B9
Species : Mus musculus (Mouse)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Research Area : Others
Source : E.coli
Gene Names : Cxcl9
Expression Region : 22-126aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :
Mol. Weight : 16.2kDa
Protein Description : Full Length
Contact us
Copyright © 2007-2015 www.cusabio.com Cusabio Biotech Co., Ltd All Rights Reserved.