Register | Sign In Professional and Accurate! We are your good partner in biology research.
cusabio

Product Name:

Recombinant Mouse Growth-regulated alpha protein(Cxcl1),partial

Product Type : Recombinant Protein
Code : CSB-RP092174m
Size : Pls inquiry other sizes
Uniprot NO. : P12850
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Relevance : Has chotactic activity for neutrophils. Contributes to neutrophil activation during inflammation . Hatoregulatory chokine, which, in vitro, suppresses hatopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hatopoietic activity.1 Publication
Image :
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References : The platelet-derived growth factor-inducible KC gene encodes a secretory protein related to platelet alpha-granule proteins.Oquendo P., Alberta J., Wen D., Graycar J.L., Derynck R., Stiles C.D.J. Biol. Chem. 264:4133-4137(1989)
Storage Buffer : Tris-based buffer,50% glycerol
Alias : C-X-C motif chemokine 1;Platelet-derived growth factor-inducible protein KCSecretory protein N51
Species : Mus musculus (Mouse)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Research Area : Others
Source : E.coli
Gene Names : Cxcl1
Expression Region : 29-96aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :
Mol. Weight : 11.5kDa
Protein Description : Partial
Contact us
Copyright © 2007-2015 www.cusabio.com Cusabio Biotech Co., Ltd All Rights Reserved.