Recombinant Human Nectin-2(NECTIN2),partial (Active)

In Stock
Code CSB-AP005081HU
Size US$3267Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to bind Human DNAM-1 in functional ELISA is less than 10 ug/ml.
Target Names NECTIN2
Uniprot No. Q92692
Research Area Immunology
Alternative Names CD 112; CD112; CD112 antigen; Herpes virus entry mediator B; Herpes virus entry protein B; Herpesvirus entry mediator B; Herpesvirus entry protein B; Hve B; HveB; Nectin-2; Nectin2; Poliovirus receptor like 2; Poliovirus receptor related 2 (herpesvirus entry mediator B); Poliovirus receptor related 2; Poliovirus receptor related protein 2; Poliovirus receptor-related protein 2; PRR 2; PRR2; PVRL 2; PVRL2; PVRL2_HUMAN; PVRR 2; PVRR2
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 32-360aa
Complete Sequence QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Mol. Weight 36.58 kDa
Protein Length Extracellular Domain
Tag Info C-terminal 6xHis-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive
Gene References into Functions
  1. Nectin-2 mutation in men with severe teratospermia PMID: 28689229
  2. In the infection with 3 MLD50 (50 % mouse lethal dose), effective resistance was not observed in transgenic mice expressing nectin-2Ig. PMID: 28671524
  3. Our data provide important structural and biochemical determinants responsible for the recognition of nectin-2 by TIGIT. PMID: 27978489
  4. Chromosomal breakpoints involved the PVRR2 gene in 19q31 is associated with Diffuse Large B-Cell Lymphomas. PMID: 27356265
  5. energetic basis for the TIGIT/nectin-2 interaction and revealed that an "aromatic key" of nectin-2 is critical for this interaction, whereas variations in the lock were tolerated. PMID: 28515320
  6. PVRL2 is a plasma cholesterol-responsive gene acting at endothelial sites of vascular inflammation to regulate transendothelial migration of leukocytes. PMID: 28062492
  7. Serum levels of nectin-2 may have diagnostic roles for colorectal cancer patients. PMID: 26184725
  8. Soluble form of nectin-2 is required for exerting the resistance against HSV-2 infection. PMID: 26982466
  9. PVRL2, TOMM40 and APOE might be associated with human longevity. PMID: 24924924
  10. Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation. PMID: 24116228
  11. Chorionic gonadotropin induces vascular endothelial growth factor (VEGFA)-dependent downregulation of nectin 2, which increases the endothelial permeability in the coculture system. PMID: 23465821
  12. Structure of Nectin-2 reveals determinants of homophilic and heterophilic interactions that control cell-cell adhesion. PMID: 22927415
  13. a possible etiologic role of PRR2 in nonsyndromic cleft lip with or without cleft palate PMID: 20662561
  14. The CD112 is highly expressed in colon carcinoma tissues and cell lines. PMID: 20617580
  15. The authors now show that human cytomegalovirus targets CD112 for proteasome-mediated degradation by 48 h post-infection, thus removing both activating ligands for DNAM-1 from the cell surface during productive infection. PMID: 20410314
  16. differences in the N termini of herpes simplex virus type 1 and 2 gDs that influence functional interactions with the human entry receptor Nectin-2 PMID: 12915581
  17. There is an allelic association of sequence variation in PVRL2 and the severity of multiple sclerosis. PMID: 16738668
  18. CD226/CD112 (DNAM-1/Nectin-2) mast cell stimulation has a role in the allergic process PMID: 16831868
  19. identified PVRL2 as a new recurrent partner gene of the TRA@ locus in peripheral T-cell lymphoma PMID: 17696193
  20. Crystallization and preliminary X-ray analysis of the V domain of human nectin-2 are reported. PMID: 19478445
  21. Regions of nectin-2 protein important for herpesvirus entry activity and homotypic nectin-nectin interactions are overlapping but not identical. PMID: 12438620

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Nectin family
Tissue Specificity Ubiquitous.
Database Links

HGNC: 9707

OMIM: 600798

KEGG: hsa:5819

STRING: 9606.ENSP00000252483

UniGene: Hs.655455

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1