Recombinant Human Nectin-2(NECTIN2),partial (Active)

In Stock
Code CSB-AP005081HU
Product Type CD Antigen
Size $104Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q92692
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Alias Poliovirus Receptor-Related Protein 2; Herpes Virus Entry Mediator B; Herpesvirus Entry Mediator B; HveB; Nectin-2; CD112; PVRL2; HVEB; PRR2
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human DNAM-1 in functional ELISA is less than 10 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Research Area Immunology
Source Mammalian cell
Gene Names NECTIN2
Expression Region 32-360aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 36.58 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Nectin family
Tissue Specificity Ubiquitous.
Database Links

HGNC: 9707

OMIM: 600798

KEGG: hsa:5819

STRING: 9606.ENSP00000252483

UniGene: Hs.655455

Pathway Adherens junction

Related Products

NECTIN2 Antibodies

NECTIN2 Antibodies for Homo sapiens (Human)

NECTIN2 Antibodies for Human

NECTIN2 Proteins

NECTIN2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.