Product Details

Purity

>95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM

Target Names

ME2

Uniprot No.

P23368

Research Area

Signal Transduction

Alternative Names

Malate dehydrogenase; Malic enzyme 2; Malic enzyme 2 mitochondrial; Malic enzyme 2 NAD(+) dependent mitochondrial; Malic enzyme mitochondrial; Malic enzyme NAD(+) dependent mitochondrial; MAOM_HUMAN; ME 2; ME2; mitochondrial; NAD dependent malic enzyme mitochondrial; NAD ME; NAD-dependent malic enzyme; NAD-ME; ODS1; Pyruvic malic carboxylase

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

19-584aa

Complete Sequence

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH

Mol. Weight

64.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2μm filtered PBS, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

5-10 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Mitochondrial NAD-dependent malic enzyme (ME2) occupies a critical metabolic node linking the TCA cycle to NADPH production, making it an emerging target in cancer metabolism research. This recombinant human ME2 (residues 19–584, full-length mature protein) carries a C-terminal 6xHis tag positioned away from the catalytic domain, preserving native enzymatic function as confirmed by a validated Km of 1.5 ± 0.6 mM for malate under spectrophotometric assay conditions (340 nm, Tris-HCl/MnCl₂/fumarate activation system). The measured kinetic parameters support direct use in substrate specificity profiling, Vmax and kcat determination, inhibitor screening with IC50 quantification, and drug candidate mechanism-of-inhibition studies. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the stringent criteria required for accurate kinetic measurements, positive-control applications in enzyme-linked assays, and structural studies such as crystallography.

Target Background

Gene References into Functions

ME2 was involved in glioblastoma multiforme growth, invasion, migration, Reactive oxygen species and ATP production. PMID: 27166188
deletion of malic enzyme 2 confers collateral lethality in pancreatic cancer PMID: 28099419
Data indicate that malic enzyme 2 knockdown impacts phosphatidylinositol 3-kinases/proto-oncogene protein akt (PI3K/AKT) signaling. PMID: 24957098
ME2 might be an important factor in melanoma progression and a novel biomarker of invasion. PMID: 25202825
Three SNP alleles in BRD2, Cx-36, and ME2 and microdeletions in 15q13.3, 15q11.2, and 16p13.11 also contribute risk to juvenile myclonic epilepsy. PMID: 23756480
Depletion of malic enzyme 2 induced erythroid differentiation in human erythroleukemia cells. PMID: 20824065
An ME2-centered nine-SNP haplotype, when present homozygously, increases the risk for IGE (odds ratio 6.1; 95% confidence interval 2.9-12.7) compared with any other genotype PMID: 15532013
Site directed mutagenesis was used to detrmine which amino acids in the active site of human mitochondrial NAD+-dependent malic enzyme are necessary for the inhibitory effects of ATP. PMID: 16171388
These findings provide a molecular rationale for the role of hS14 in TR-dependent transcriptional activation of the expression of specific genes. PMID: 17418816
Schizophrenic subjects are identified with mitochondrial genes involved in oxidative metabolism as showing consistently decreased expression, including ME2. PMID: 17638511
Single nucleotide polymorphism in ME2 gene is associated with acute lymphoblastic leukemia. PMID: 19066393
ME2 activity in Islets of Langerhans cells was measured by a spectrophotometric enzyme assay by utilizing the distinct kinetic properties. PMID: 19691144

Hide All

Subcellular Location

Mitochondrion matrix.

Protein Families

Malic enzymes family

Database Links

HGNC: 6984

OMIM: 154270

KEGG: hsa:4200

STRING: 9606.ENSP00000321070

UniGene: Hs.233119

Code	CSB-AP000101HU
Abbreviation	Recombinant Human ME2 protein (Active)
MSDS	MSDS Datasheet
Size	$142
	Order now
Image
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage