Recombinant Human NAD-dependent malic enzyme, mitochondrial protein(ME2) (Active)

In Stock

Code CSB-AP000101HU
Product Type Enzyme
Size US$112Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P23368
Lead Time 5-10 business days
Image
Storage Buffer 0.2μm filtered PBS, pH 7.4. ,lyophilized
Alias NAD-ME, Malic enzyme 2
Species Homo sapiens (Human)
Biological_Activity Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM
Purity >95% as determined by SDS-PAGE and HPLC.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH
Research Area Signal Transduction
Source E.coli
Gene Names ME2
Expression Region 19-584aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 64.4 kDa
Protein Description Full Length of Mature Protein
PubMed ID 1993674; 11401430; 14702039; 16177791; 15489334; 12665801; 19608861; 21269460; 24275569; 10467136; 10700286; 12121650; 12962632
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Mitochondrion matrix
Protein Families Malic enzymes family
Database Links

HGNC: 6984

OMIM: 154270

KEGG: hsa:4200

STRING: 9606.ENSP00000321070

UniGene: Hs.233119

Related Products

ME2 Antibodies

ME2 Antibodies for Homo sapiens (Human)

ME2 Antibodies for Human

ME2 Proteins

ME2 Proteins for Homo sapiens (Human)

ME2 Proteins for Mus musculus (Mouse)

ME2 cDNA

ME2 cDNA for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.