Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) (Active)

In Stock
Code CSB-AP000101HU
Abbreviation Recombinant Human ME2 protein (Active)
MSDS
Size $142
Order now
Image
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Malate dehydrogenase; Malic enzyme 2; Malic enzyme 2 mitochondrial; Malic enzyme 2 NAD(+) dependent mitochondrial; Malic enzyme mitochondrial; Malic enzyme NAD(+) dependent mitochondrial; MAOM_HUMAN; ME 2; ME2; mitochondrial; NAD dependent malic enzyme mitochondrial; NAD ME; NAD-dependent malic enzyme; NAD-ME; ODS1; Pyruvic malic carboxylase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-584aa
Complete Sequence
MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH
Mol. Weight
64.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2μm filtered PBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
5-10 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein (ME2) is produced in an E. coli expression system, covering the full-length mature protein from amino acids 19 to 584. The protein carries a C-terminal 6xHis-tag, which simplifies purification and detection processes. SDS-PAGE analysis confirms the protein achieves high purity, exceeding 95%. Biological activity remains intact, as demonstrated by spectrophotometric assay results showing a Km value of 1.5 ± 0.6 mM. Endotoxin levels stay below 1.0 EU/μg, making it appropriate for research work.

The NAD-dependent malic enzyme (ME2) appears to play a central role in mitochondrial function by converting malate to pyruvate—a step that may be critical for cellular metabolism. This reaction seems essential for maintaining NAD/NADH balance within mitochondria, which likely influences metabolic pathways, including the citric acid cycle. ME2's involvement in energy production and redox balance makes it a compelling target for research in metabolic regulation and related areas.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Enzyme Kinetics and Inhibitor Screening Studies

This application is highly valid and strongly supported. The recombinant ME2 protein has confirmed enzymatic activity with a defined Km value (1.5 ± 0.6 mM) and a standardized spectrophotometric assay. This makes it excellent for detailed kinetic studies, including substrate specificity, cofactor requirements, and inhibitor screening. The high purity (>95%) ensures reliable and reproducible results for determining kinetic parameters like Vmax, kcat, and Ki values for potential inhibitors.

2. Metabolic Pathway Analysis in Cell-Free Systems

This application is feasible with an important caveat. The active recombinant ME2 can indeed be used in reconstituted metabolic systems to study the malate-aspartate shuttle or pyruvate metabolism. However, it should be noted that while the protein is the mature human mitochondrial enzyme, it was expressed in E. coli and lacks mitochondrial localization. Therefore, while valuable for pathway biochemistry, results may not fully replicate the mitochondrial environment without additional factors.

3. Antibody Development and Validation

This application is well-supported. The high purity, low endotoxin levels, and confirmed native activity make this recombinant ME2 protein an excellent immunogen for generating specific antibodies. The C-terminal 6xHis tag facilitates purification and screening. Since the recombinant ME2 protein is functionally active, antibodies generated are more likely to recognize the native, properly folded ME2 in biological samples.

4. Protein-Protein Interaction Studies

This application is potentially feasible but requires caution. While the His-tag enables pull-down experiments, ME2 primarily functions as a metabolic enzyme rather than a scaffold protein with multiple interaction partners. The C-terminal tag position is less likely to interfere with the active site, but the relevance of identified interactions should be validated biologically. The high purity reduces background noise in such experiments.

5. Structural and Biophysical Characterization

This application is highly appropriate. The confirmed enzymatic activity indicates proper folding, making this recombinant ME2 protein suitable for biophysical studies. Techniques like analytical ultracentrifugation can investigate its oligomeric state, while thermal shift assays can study stability. The protein can also be used for structural studies using X-ray crystallography or cryo-EM, particularly to understand substrate/cofactor binding.

Final Recommendation & Action Plan

This recombinant ME2 is a high-quality, functionally validated reagent suitable for most proposed applications. The immediate priority should be leveraging its confirmed enzymatic activity for detailed kinetic studies (Application 1) and metabolic pathway reconstitution (Application 2). For interaction studies (Application 4), focus on known metabolic complexes rather than exploratory screening. The protein is excellent for antibody development (Application 3) and structural studies (Application 5). Researchers should note that while bacterial expression provides ample protein, post-translational modifications may differ from native mitochondrial ME2. All kinetic studies should use the established assay conditions as a starting point, and any identified interactors or inhibitors should be validated in cellular models.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. ME2 was involved in glioblastoma multiforme growth, invasion, migration, Reactive oxygen species and ATP production. PMID: 27166188
  2. deletion of malic enzyme 2 confers collateral lethality in pancreatic cancer PMID: 28099419
  3. Data indicate that malic enzyme 2 knockdown impacts phosphatidylinositol 3-kinases/proto-oncogene protein akt (PI3K/AKT) signaling. PMID: 24957098
  4. ME2 might be an important factor in melanoma progression and a novel biomarker of invasion. PMID: 25202825
  5. Three SNP alleles in BRD2, Cx-36, and ME2 and microdeletions in 15q13.3, 15q11.2, and 16p13.11 also contribute risk to juvenile myclonic epilepsy. PMID: 23756480
  6. Depletion of malic enzyme 2 induced erythroid differentiation in human erythroleukemia cells. PMID: 20824065
  7. An ME2-centered nine-SNP haplotype, when present homozygously, increases the risk for IGE (odds ratio 6.1; 95% confidence interval 2.9-12.7) compared with any other genotype PMID: 15532013
  8. Site directed mutagenesis was used to detrmine which amino acids in the active site of human mitochondrial NAD+-dependent malic enzyme are necessary for the inhibitory effects of ATP. PMID: 16171388
  9. These findings provide a molecular rationale for the role of hS14 in TR-dependent transcriptional activation of the expression of specific genes. PMID: 17418816
  10. Schizophrenic subjects are identified with mitochondrial genes involved in oxidative metabolism as showing consistently decreased expression, including ME2. PMID: 17638511
  11. Single nucleotide polymorphism in ME2 gene is associated with acute lymphoblastic leukemia. PMID: 19066393
  12. ME2 activity in Islets of Langerhans cells was measured by a spectrophotometric enzyme assay by utilizing the distinct kinetic properties. PMID: 19691144

Show More

Hide All

Subcellular Location
Mitochondrion matrix.
Protein Families
Malic enzymes family
Database Links

HGNC: 6984

OMIM: 154270

KEGG: hsa:4200

STRING: 9606.ENSP00000321070

UniGene: Hs.233119

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*